RNF207 Antibody

Images

 
Western Blot: RNF207 Antibody [NBP1-54794] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF207 Antibody Summary

Immunogen
Synthetic peptides corresponding to RNF207(ring finger protein 207) The peptide sequence was selected from the N terminal of RNF207 (NP_997279). Peptide sequence CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF207
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RNF207 and was validated on Western blot.
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF207 Antibody

  • C1orf188
  • chromosome 1 open reading frame 188
  • FLJ32096
  • FLJ46380
  • FLJ46593
  • ring finger protein 207

Background

RNF207 contains 1 B box-type zinc finger and 1 RING-type zinc finger. The function of the RNF207 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-804
Species: Hu, Mu, Rt, Bv, Ca
Applications: IHC, IHC-P, PEP-ELISA
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4695
Species: Hu
Applications: WB, IHC, ICC
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003757-Q01
Species: Hu
23320002
Species: Hu
Applications: ELISA, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, B/N, ICC/IF, IP, PLA
NBP1-83426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84492
Species: Hu
Applications: IHC, IHC-P
NBP1-92300
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93620
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00065009-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-60414
Species: Hu
Applications: WB, IP
AF3495
Species: Hu
Applications: WB, IHC
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
AF7970
Species: Mu
Applications: WB

Publications for RNF207 Antibody (NBP1-54794) (0)

There are no publications for RNF207 Antibody (NBP1-54794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF207 Antibody (NBP1-54794) (0)

There are no reviews for RNF207 Antibody (NBP1-54794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF207 Antibody (NBP1-54794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RNF207 Antibody (NBP1-54794)

Discover related pathways, diseases and genes to RNF207 Antibody (NBP1-54794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF207 Antibody (NBP1-54794)

Discover more about diseases related to RNF207 Antibody (NBP1-54794).
 

Pathways for RNF207 Antibody (NBP1-54794)

View related products by pathway.

Research Areas for RNF207 Antibody (NBP1-54794)

Find related products by research area.

Blogs on RNF207

There are no specific blogs for RNF207, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF207 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF207
Entrez
Uniprot