RNF144A Antibody


Immunocytochemistry/ Immunofluorescence: RNF144A Antibody [NBP2-13238] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: RNF144A Antibody [NBP2-13238] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RNF144A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQR YKKLQFEREVLFDPCRTWCPASTCQAVC
Specificity of human RNF144A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF144A Protein (NBP2-13238PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNF144A Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A
  • ring finger protein 144Aring finger protein 144
  • RNF144
  • UbcM4-interacting protein 4
  • ubiquitin conjugating enzyme 7 interacting protein 4
  • Ubiquitin-conjugating enzyme 7-interacting protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Eq
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RNF144A Antibody (NBP2-13238) (0)

There are no publications for RNF144A Antibody (NBP2-13238).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF144A Antibody (NBP2-13238) (0)

There are no reviews for RNF144A Antibody (NBP2-13238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNF144A Antibody (NBP2-13238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RNF144A Products

Bioinformatics Tool for RNF144A Antibody (NBP2-13238)

Discover related pathways, diseases and genes to RNF144A Antibody (NBP2-13238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF144A Antibody (NBP2-13238)

Discover more about diseases related to RNF144A Antibody (NBP2-13238).

Pathways for RNF144A Antibody (NBP2-13238)

View related products by pathway.

Research Areas for RNF144A Antibody (NBP2-13238)

Find related products by research area.

Blogs on RNF144A

There are no specific blogs for RNF144A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNF144A Antibody and receive a gift card or discount.


Gene Symbol RNF144A