RNF144A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RNF144A Antibody [NBP2-13238] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry-Paraffin: RNF144A Antibody [NBP2-13238] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF144A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNF144A Antibody - BSA Free (NBP2-13238) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF144A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF144A Protein (NBP2-13238PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RNF144A Antibody - BSA Free

• EC 6.3.2
• EC 6.3.2.-
• KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A
• ring finger protein 144Aring finger protein 144
• RNF144
• UbcM4-interacting protein 4
• ubiquitin conjugating enzyme 7 interacting protein 4
• Ubiquitin-conjugating enzyme 7-interacting protein 4

Background

RNF144A is encoded by this protein contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. The mouse counterpart of this protein has been shown to interact with Ube2l3/UbcM4, which is an ubiquitin-conjugating enzyme involved in embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF144A