ATF7IP2 Antibody

Images

 
Western Blot: ATF7IP2 Antibody [NBP1-94029] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ATF7IP2 Antibody [NBP1-94029] - Staining of human testis shows strong nuclear positivity in cells in seminiferus tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATF7IP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RNKHEGIADKLLAKIAKLQRRIKTVLLFQRNCLKPNMLSSNGASKVANSEAMILDKNLESVNSPIEKSSVNYEPSNPSEKGSKKINLSSDQNKSVSESNNDD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF7IP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATF7IP2 Protein (NBP1-94029PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF7IP2 Antibody

  • activating transcription factor 7 interacting protein 2
  • activating transcription factor 7-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84610
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-56537
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
H00004212-M01
Species: Hu, Pm, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-91816
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-20322
Species: Hu, Mu
Applications: ChIP, ICC, IHC, IHC-P, IP, PLA, WB
NBP1-86769
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-85993
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP1-59195
Species: Hu, Mu
Applications: ICC/IF, WB
AF5286
Species: Hu
Applications: WB
NBP3-10064
Species: Hu
Applications: WB

Publications for ATF7IP2 Antibody (NBP1-94029) (0)

There are no publications for ATF7IP2 Antibody (NBP1-94029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF7IP2 Antibody (NBP1-94029) (0)

There are no reviews for ATF7IP2 Antibody (NBP1-94029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF7IP2 Antibody (NBP1-94029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF7IP2 Products

Bioinformatics Tool for ATF7IP2 Antibody (NBP1-94029)

Discover related pathways, diseases and genes to ATF7IP2 Antibody (NBP1-94029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF7IP2 Antibody (NBP1-94029)

Discover more about diseases related to ATF7IP2 Antibody (NBP1-94029).
 

Pathways for ATF7IP2 Antibody (NBP1-94029)

View related products by pathway.

PTMs for ATF7IP2 Antibody (NBP1-94029)

Learn more about PTMs related to ATF7IP2 Antibody (NBP1-94029).

Blogs on ATF7IP2

There are no specific blogs for ATF7IP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF7IP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF7IP2