RNF135 Antibody

Images

 
Western Blot: RNF135 Antibody [NBP2-56223] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: RNF135 Antibody [NBP2-56223] - Staining of human cell line A-431 shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF135 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
Specificity
Specificity of human RNF135 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF135
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF135 Recombinant Protein Antigen (NBP2-56223PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RNF135 Antibody

  • E3 ubiquitin-protein ligase RNF135
  • EC 6.3.2.-
  • MGC13061
  • REUL
  • ring finger protein 135RIG-I E3 ubiquitin ligase
  • Riplet

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00058516-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-97838
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-88192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93190
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-87847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNF135 Antibody (NBP2-56223) (0)

There are no publications for RNF135 Antibody (NBP2-56223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF135 Antibody (NBP2-56223) (0)

There are no reviews for RNF135 Antibody (NBP2-56223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF135 Antibody (NBP2-56223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF135 Products

Bioinformatics Tool for RNF135 Antibody (NBP2-56223)

Discover related pathways, diseases and genes to RNF135 Antibody (NBP2-56223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF135 Antibody (NBP2-56223)

Discover more about diseases related to RNF135 Antibody (NBP2-56223).
 

Pathways for RNF135 Antibody (NBP2-56223)

View related products by pathway.

PTMs for RNF135 Antibody (NBP2-56223)

Learn more about PTMs related to RNF135 Antibody (NBP2-56223).
 

Research Areas for RNF135 Antibody (NBP2-56223)

Find related products by research area.

Blogs on RNF135

There are no specific blogs for RNF135, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF135 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF135