RNF135 Antibody - BSA Free

Western Blot: RNF135 Antibody [NBP2-56223] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: RNF135 Antibody [NBP2-56223] - Staining of human cell line A-431 shows localization to vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF135 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNF135 Antibody - BSA Free (NBP2-56223) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF135
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF135 Recombinant Protein Antigen (NBP2-56223PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNF135 Antibody - BSA Free

• E3 ubiquitin-protein ligase RNF135
• EC 6.3.2.-
• MGC13061
• REUL
• ring finger protein 135RIG-I E3 ubiquitin ligase
• Riplet

Background

RNF135 is encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF135