RNF111 Antibody (NBP1-94139)

Images

 
Immunocytochemistry/ Immunofluorescence: RNF111 Antibody [NBP1-94139] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RNF111 Antibody [NBP1-94139] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF111 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF111
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
This antibody is useful in Immunohistochemistry-Paraffin and Immunofluorescence. For IHC-Paraffin HIER pH6 retrieval is recommended. Immunofluorescence fixation permeabilization: PFA/Triton X-100.
Control Peptide
RNF111 Protein (NBP1-94139PEP)
Publications
Read Publication using
NBP1-94139 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%). Human reactivity reported in scientific literature (PMID: 26522722).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF111 Antibody

  • ARK
  • Arkadia
  • DKFZp313E0731
  • DKFZP761D081
  • E3 ubiquitin-protein ligase Arkadia
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ38008
  • ring finger protein 111DKFZp686H1966

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF885
Species: Hu
Applications: WB, IHC
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-81646
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB600-231
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for RNF111 Antibody (NBP1-94139)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RNF111 Antibody (NBP1-94139) (0)

There are no reviews for RNF111 Antibody (NBP1-94139). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNF111 Antibody (NBP1-94139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF111 Products

Related Products by Gene

Bioinformatics Tool for RNF111 Antibody (NBP1-94139)

Discover related pathways, diseases and genes to RNF111 Antibody (NBP1-94139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF111 Antibody (NBP1-94139)

Discover more about diseases related to RNF111 Antibody (NBP1-94139).
 

Pathways for RNF111 Antibody (NBP1-94139)

View related products by pathway.

PTMs for RNF111 Antibody (NBP1-94139)

Learn more about PTMs related to RNF111 Antibody (NBP1-94139).
 

Research Areas for RNF111 Antibody (NBP1-94139)

Find related products by research area.

Blogs on RNF111

There are no specific blogs for RNF111, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF111 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF111