RND1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RND1 Antibody [NBP3-35379] - Immunofluorescence analysis of L929 cells using RND1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: RND1 Antibody [NBP3-35379] - Western blot analysis of various lysates using RND1 Rabbit pAb at 1:3000 dilution.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RND1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RND1 Antibody - BSA Free (NBP3-35379) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 133-232 of human RND1 (NP_055285.1).
  
  Sequence:
  EQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RND1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RND1 Antibody - BSA Free

• ARHS
• GTP-binding protein
• ras homolog gene family, member S
• Rho family GTPase 1FLJ42294
• RHO6
• rho-related GTP-binding protein Rho6
• RHOS
• Rnd1

Background

Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors (Nobes et al., 1998 [PubMed 9531558]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RND1