RNASEH2A Antibody - BSA Free

Western Blot: RNASEH2A Antibody [NBP1-58234] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: RNASEH2A Antibody [NBP1-58234] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RNASEH2A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RNASEH2A(ribonuclease H2, subunit A) The peptide sequence was selected from the C terminal of RNASEH2A. Peptide sequence EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: A.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNASEH2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RNASEH2A Antibody - BSA Free

• AGS4RNase H2 subunit A
• Aicardi-Goutieres syndrome 4 protein
• Aicardi-Goutieres syndrome 4
• JUNB
• ribonuclease H2 subunit A
• ribonuclease H2, large subunit
• ribonuclease H2, subunit A
• Ribonuclease HI large subunit
• Ribonuclease HI subunit A
• ribonuclease HI, large subunit
• RNase H(35)
• RNASEHIEC 3.1.26.4
• RNHIARNase HI large subunit
• RNHL

Background

Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNASEH2A
• Uniprot:
  • O75792(Human)