RNA polymerase I termination factor Recombinant Protein Antigen

Images

 
There are currently no images for RNA polymerase I termination factor Protein (NBP2-38740PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RNA polymerase I termination factor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TTF1.

Source: E. coli

Amino Acid Sequence: VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TTF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38740.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNA polymerase I termination factor Recombinant Protein Antigen

  • RNA polymerase I termination factor
  • transcription termination factor 1
  • Transcription termination factor I
  • transcription termination factor, RNA polymerase I
  • TTF-1
  • TTF-I

Background

The TTF1 gene encodes a 905 amino acid long, 103 kDA transcription termination factor 1 protein, also known as a RNA polymerase I termination factor, which functions in terminating ribosomal gene transcription. Additionally, it regulates fork arrest replication and RNA polymerase I transcription on chromatin. Through monitoring the activation as well as the silencing of rDNA transcription, TTF1 acts in rDNA regulation. TTF1 functions in RNA polymerase I transcription as well as mitochondrial transcription and gene expression. It is known to interact with genes PTRF, NFATC3, BAZ2A, SMAD1, and SMAD7. TTF1 has been researched regarding its role in lung cancer, small cell carcinoma, sex cord-gonadal stromal tumor, thyroiditis, blastoma, adenocarcinoma, desmoplastic small round cell tumors, and hirschsprung's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
AF7355
Species: Hu
Applications: ICC, Simple Western, WB
H00006439-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP1-80670
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP1-32440
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, Single-Cell Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-87201
Species: Hu
Applications: IHC,  IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P
NB100-1271
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for RNA polymerase I termination factor Protein (NBP2-38740PEP) (0)

There are no publications for RNA polymerase I termination factor Protein (NBP2-38740PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA polymerase I termination factor Protein (NBP2-38740PEP) (0)

There are no reviews for RNA polymerase I termination factor Protein (NBP2-38740PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RNA polymerase I termination factor Protein (NBP2-38740PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNA polymerase I termination factor Products

Blogs on RNA polymerase I termination factor

There are no specific blogs for RNA polymerase I termination factor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNA polymerase I termination factor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TTF1