Recombinant Human RNA Helicase A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNA Helicase A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human DHX9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DHX9

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNA Helicase A Protein

  • DDX9ATP-dependent RNA helicase A
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9
  • DEAH (Asp-Glu-Ala-His) box polypeptide 9
  • DEAH box protein 9
  • EC 3.6.1
  • EC 3.6.1.15
  • EC 3.6.4.13
  • FLJ17406
  • leukophysin
  • LKP
  • NDH II
  • NDH2
  • NDHII
  • Nuclear DNA helicase II
  • RHA

Background

DHX9 - DEAH (Asp-Glu-Ala-His) box polypeptide 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF3757
Species: Hu
Applications: WB, ICC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-02456
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNA Helicase A Partial Recombinant Protein (H00001660-Q01) (0)

There are no publications for RNA Helicase A Partial Recombinant Protein (H00001660-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Helicase A Partial Recombinant Protein (H00001660-Q01) (0)

There are no reviews for RNA Helicase A Partial Recombinant Protein (H00001660-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNA Helicase A Partial Recombinant Protein (H00001660-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I would like to know the expression host of the RNA Helicase A product H00001660-Q10
    • This product is distributed by Novus for a Taiwanese company called Abnova. Their proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-translational modifications they might undergo in an endogenous cell. Due to this production system, we do not suggest these proteins for use in functional assays (unless recommend on the datasheet) and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody.

Additional RNA Helicase A Products

Bioinformatics Tool for RNA Helicase A Partial Recombinant Protein (H00001660-Q01)

Discover related pathways, diseases and genes to RNA Helicase A Partial Recombinant Protein (H00001660-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA Helicase A Partial Recombinant Protein (H00001660-Q01)

Discover more about diseases related to RNA Helicase A Partial Recombinant Protein (H00001660-Q01).
 

Pathways for RNA Helicase A Partial Recombinant Protein (H00001660-Q01)

View related products by pathway.

PTMs for RNA Helicase A Partial Recombinant Protein (H00001660-Q01)

Learn more about PTMs related to RNA Helicase A Partial Recombinant Protein (H00001660-Q01).
 

Research Areas for RNA Helicase A Partial Recombinant Protein (H00001660-Q01)

Find related products by research area.

Blogs on RNA Helicase A

There are no specific blogs for RNA Helicase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNA Helicase A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX9