RNA Helicase A Antibody (1D10)

Images

 
Sandwich ELISA: RNA Helicase A Antibody (1D10) [H00001660-M03] - Detection limit for recombinant GST tagged DHX9 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNA Helicase A Antibody (1D10) Summary

Immunogen
DHX9 (NP_001348, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHX9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNA Helicase A Antibody (1D10)

  • DDX9ATP-dependent RNA helicase A
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9
  • DEAH (Asp-Glu-Ala-His) box polypeptide 9
  • DEAH box protein 9
  • EC 3.6.1
  • EC 3.6.1.15
  • EC 3.6.4.13
  • FLJ17406
  • leukophysin
  • LKP
  • NDH II
  • NDH2
  • NDHII
  • Nuclear DNA helicase II
  • RHA

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF3757
Species: Hu
Applications: WB, ICC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNA Helicase A Antibody (H00001660-M03) (0)

There are no publications for RNA Helicase A Antibody (H00001660-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Helicase A Antibody (H00001660-M03) (0)

There are no reviews for RNA Helicase A Antibody (H00001660-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNA Helicase A Antibody (H00001660-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNA Helicase A Products

Bioinformatics Tool for RNA Helicase A Antibody (H00001660-M03)

Discover related pathways, diseases and genes to RNA Helicase A Antibody (H00001660-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA Helicase A Antibody (H00001660-M03)

Discover more about diseases related to RNA Helicase A Antibody (H00001660-M03).
 

Pathways for RNA Helicase A Antibody (H00001660-M03)

View related products by pathway.

PTMs for RNA Helicase A Antibody (H00001660-M03)

Learn more about PTMs related to RNA Helicase A Antibody (H00001660-M03).
 

Research Areas for RNA Helicase A Antibody (H00001660-M03)

Find related products by research area.

Blogs on RNA Helicase A

There are no specific blogs for RNA Helicase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNA Helicase A Antibody (1D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX9
Uniprot