RLK/TXK Antibody (2G3)

Images

 
There are currently no images for RLK/TXK Antibody (H00007294-M03).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RLK/TXK Antibody (2G3) Summary

Immunogen
TXK (NP_003319, 131 a.a. - 230 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWY
Specificity
TXK (2G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TXK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RLK/TXK Antibody (2G3)

  • BTKL
  • BTKLEC 2.7.10.2
  • EC 2.7.10
  • MGC22473
  • Protein-tyrosine kinase 4
  • PSCTK5
  • PTK4 protein tyrosine kinase 4
  • PTK4
  • RLK
  • TKL
  • TXK tyrosine kinase
  • TXK
  • tyrosine kinase
  • tyrosine-protein kinase TXK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5887
Species: Hu
Applications: WB, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
MAB6519
Species: Hu, Mu
Applications: WB, IHC
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RLK/TXK Antibody (H00007294-M03) (0)

There are no publications for RLK/TXK Antibody (H00007294-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RLK/TXK Antibody (H00007294-M03) (0)

There are no reviews for RLK/TXK Antibody (H00007294-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RLK/TXK Antibody (H00007294-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RLK/TXK Products

Bioinformatics Tool for RLK/TXK Antibody (H00007294-M03)

Discover related pathways, diseases and genes to RLK/TXK Antibody (H00007294-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RLK/TXK Antibody (H00007294-M03)

Discover more about diseases related to RLK/TXK Antibody (H00007294-M03).
 

Pathways for RLK/TXK Antibody (H00007294-M03)

View related products by pathway.

PTMs for RLK/TXK Antibody (H00007294-M03)

Learn more about PTMs related to RLK/TXK Antibody (H00007294-M03).
 

Research Areas for RLK/TXK Antibody (H00007294-M03)

Find related products by research area.

Blogs on RLK/TXK

There are no specific blogs for RLK/TXK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RLK/TXK Antibody (2G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TXK
Entrez
OMIM
Uniprot