RIPK4 Antibody (2G3)

Images

 
Western Blot: RIPK4 Antibody (2G3) [H00054101-M01] - RIPK4 monoclonal antibody (M01), clone 2G3 Analysis of RIPK4 expression in A-431.
ELISA: RIPK4 Antibody (2G3) [H00054101-M01] - Detection limit for recombinant GST tagged RIPK4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RIPK4 Antibody (2G3) Summary

Immunogen
RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Specificity
RIPK4 - receptor-interacting serine-threonine kinase 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RIPK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00054101-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIPK4 Antibody (2G3)

  • ANKK2
  • ANKRD3MGC129993
  • ankyrin repeat domain 3
  • Ankyrin repeat domain-containing protein 3
  • DIKMGC129992
  • EC 2.7.11
  • EC 2.7.11.1
  • PKC-delta-interacting protein kinase
  • PKK
  • receptor-interacting serine/threonine-protein kinase 4
  • receptor-interacting serine-threonine kinase 4
  • RIP4
  • serine/threonine-protein kinase ANKRD3

Background

The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF, KD
NBP2-12555
Species: Hu
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, Gp, Ma-Op, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, PAGE, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP2-76966
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, GS, KD, KO
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67615
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67832
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RIPK4 Antibody (H00054101-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RIPK4 Products

Array H00054101-M01

Bioinformatics Tool for RIPK4 Antibody (H00054101-M01)

Discover related pathways, diseases and genes to RIPK4 Antibody (H00054101-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIPK4 Antibody (H00054101-M01)

Discover more about diseases related to RIPK4 Antibody (H00054101-M01).
 

Pathways for RIPK4 Antibody (H00054101-M01)

View related products by pathway.

PTMs for RIPK4 Antibody (H00054101-M01)

Learn more about PTMs related to RIPK4 Antibody (H00054101-M01).
 

Research Areas for RIPK4 Antibody (H00054101-M01)

Find related products by research area.

Blogs on RIPK4

There are no specific blogs for RIPK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIPK4 Antibody (2G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RIPK4
Entrez
OMIM
Uniprot