RIPK1/RIP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RIPK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23545938)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RIPK1/RIP1 Antibody - BSA Free
Background
RIP (Receptor Interacting Protein) is a 74 kD Ser/Thr kinase which interacts with CD95 (Fas/APO1) receptor and the tumor necrosis factor receptor (TNFR1). It is a cell death domain adapter protein which can bind to the adapter proteins TRADD, RAID (CRADD) and TRAF2. RIP contains an N terminal region with homology to protein kinases, an intermediate domain capable of association with MAPKKK and a C terminal region containing an intracellular death domain motif. RIP activates both p38 MAP Kinase and SAPK families. In vitro, RIP induces apoptosis, as well as SAPK/JNK and NF-kB activation. NF-kB activation through TRADD, TRAF2 and RIP can be triggered also by DR3/APO3 upon activation with APO3/Tweak ligand. DR4 and DR5 also use FADD, TRADD, and RIP in their signal transduction pathways. RIP deficient mice fail to thrive, displaying extensive apoptosis in both lymphoid and adipose tissues and dying at 1-3 days of age. RIP possesses kinase activity as it autophosphorylates itself on serine and threonine residues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, GS, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for RIPK1/RIP1 Antibody (NBP1-87128)(1)
Showing Publication 1 -
1 of 1.
Reviews for RIPK1/RIP1 Antibody (NBP1-87128) (0)
There are no reviews for RIPK1/RIP1 Antibody (NBP1-87128).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RIPK1/RIP1 Antibody (NBP1-87128) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RIPK1/RIP1 Products
Research Areas for RIPK1/RIP1 Antibody (NBP1-87128)
Find related products by research area.
|
Blogs on RIPK1/RIP1