RIPK1/RIP1 Antibody

Images

 
Western Blot: RIPK1 Antibody [NBP1-87128] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: RIPK1 Antibody [NBP1-87128] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: RIPK1 Antibody [NBP1-87128] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

RIPK1/RIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIPK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
RIPK1/RIP1 Protein (NBP1-87128PEP)
Publications
Read Publication using NBP1-87128.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23545938)

Alternate Names for RIPK1/RIP1 Antibody

  • Cell death protein RIP
  • EC 2.7.11.1
  • receptor (TNFRSF)-interacting serine-threonine kinase 1
  • receptor interacting protein
  • Receptor-interacting protein 1
  • receptor-interacting serine/threonine-protein kinase 1
  • RIP
  • Rip1 kinase
  • RIP1
  • RIP-1
  • RIPFLJ39204
  • RIPK1/RIP1
  • Serine/threonine-protein kinase RIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB225R
Species: Hu
Applications: Flow, Neut
NB100-56169
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
MAB1776
Species: Hu, Mu, Rt
Applications: WB
NB100-56141
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RIPK1/RIP1 Antibody (NBP1-87128)(1)

Reviews for RIPK1/RIP1 Antibody (NBP1-87128) (0)

There are no reviews for RIPK1/RIP1 Antibody (NBP1-87128). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RIPK1/RIP1 Antibody (NBP1-87128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIPK1/RIP1 Antibody Products

Related Products by Gene

Bioinformatics Tool for RIPK1/RIP1 Antibody (NBP1-87128)

Discover related pathways, diseases and genes to RIPK1/RIP1 Antibody (NBP1-87128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIPK1/RIP1 Antibody (NBP1-87128)

Discover more about diseases related to RIPK1/RIP1 Antibody (NBP1-87128).
 

Pathways for RIPK1/RIP1 Antibody (NBP1-87128)

View related products by pathway.

PTMs for RIPK1/RIP1 Antibody (NBP1-87128)

Learn more about PTMs related to RIPK1/RIP1 Antibody (NBP1-87128).
 

Research Areas for RIPK1/RIP1 Antibody (NBP1-87128)

Find related products by research area.

Blogs on RIPK1/RIP1

There are no specific blogs for RIPK1/RIP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RIPK1
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-87128 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought