RIPK1/RIP1 Antibody (NBP1-87128)

Images

 
Western Blot: RIPK1/RIP1 Antibody [NBP1-87128] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-477
Immunocytochemistry/ Immunofluorescence: RIPK1/RIP1 Antibody [NBP1-87128] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: RIPK1/RIP1 Antibody [NBP1-87128] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIPK1/RIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIPK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
RIPK1/RIP1 Protein (NBP1-87128PEP)
Publications
Read Publication using NBP1-87128.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23545938)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIPK1/RIP1 Antibody

  • Cell death protein RIP
  • EC 2.7.11.1
  • receptor (TNFRSF)-interacting serine-threonine kinase 1
  • receptor interacting protein
  • Receptor-interacting protein 1
  • receptor-interacting serine/threonine-protein kinase 1
  • RIP
  • Rip1 kinase
  • RIP1
  • RIP-1
  • RIPFLJ39204
  • RIPK1
  • Serine/threonine-protein kinase RIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56169
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for RIPK1/RIP1 Antibody (NBP1-87128)(1)

Reviews for RIPK1/RIP1 Antibody (NBP1-87128) (0)

There are no reviews for RIPK1/RIP1 Antibody (NBP1-87128). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RIPK1/RIP1 Antibody (NBP1-87128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIPK1/RIP1 Products

Related Products by Gene

Bioinformatics Tool for RIPK1/RIP1 Antibody (NBP1-87128)

Discover related pathways, diseases and genes to RIPK1/RIP1 Antibody (NBP1-87128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIPK1/RIP1 Antibody (NBP1-87128)

Discover more about diseases related to RIPK1/RIP1 Antibody (NBP1-87128).
 

Pathways for RIPK1/RIP1 Antibody (NBP1-87128)

View related products by pathway.

PTMs for RIPK1/RIP1 Antibody (NBP1-87128)

Learn more about PTMs related to RIPK1/RIP1 Antibody (NBP1-87128).
 

Research Areas for RIPK1/RIP1 Antibody (NBP1-87128)

Find related products by research area.

Blogs on RIPK1/RIP1

There are no specific blogs for RIPK1/RIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIPK1/RIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIPK1
Entrez