RIP5 Antibody

Images

 
Western Blot: RIP5 Antibody [NBP1-91332] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, YeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIP5 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human C20orf24. Peptide sequence MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C20orf24
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against C20orf24 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RIP5 Antibody

  • C20orf24
  • chromosome 20 open reading frame 24
  • PNAS-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30447
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-49174
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-57503
Species: Hu, Mu, Rt, Bv, Ca, GP
Applications: WB
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Pm, Rb
Applications: WB, Flow
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
NBP1-81706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for RIP5 Antibody (NBP1-91332) (0)

There are no publications for RIP5 Antibody (NBP1-91332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIP5 Antibody (NBP1-91332) (0)

There are no reviews for RIP5 Antibody (NBP1-91332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIP5 Antibody (NBP1-91332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RIP5 Products

Bioinformatics Tool for RIP5 Antibody (NBP1-91332)

Discover related pathways, diseases and genes to RIP5 Antibody (NBP1-91332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIP5 Antibody (NBP1-91332)

Discover more about diseases related to RIP5 Antibody (NBP1-91332).
 

Pathways for RIP5 Antibody (NBP1-91332)

View related products by pathway.

Blogs on RIP5

There are no specific blogs for RIP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C20orf24
Uniprot