Rif1 Recombinant Protein Antigen

Images

 
There are currently no images for Rif1 Protein (NBP2-47303PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rif1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIF1.

Source: E. coli

Amino Acid Sequence: ELNVGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLNAKEVATEEFNSDISLSDNTTPVKLNAQTEISEQTAAGELDGGNDVSDLHSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RIF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47303.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rif1 Recombinant Protein Antigen

  • DKFZp434D1026
  • DKFZp781N1478
  • FLJ10599
  • FLJ12870
  • RAP1 interacting factor homolog (yeast)
  • Rap1-interacting factor 1 homolog
  • telomere-associated protein RIF1

Background

Rif1 (Rap1-interacting factor homolog) is a protein whose primary function is in the DNA-damage response, RIF1 forms foci that colocalize with other DNA damage response factors, after induction of double-strand breaks. Rif1 localizes to double strand breaks in an ATM (ataxia telangiectasia mutated)- and 53BP1-dependent manner and functions in the intra-S-phase checkpoint that serves to slow down DNA synthesis when DNA damage has occurred.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-1923
Species: Ce
Applications: IHC,  IHC-P, IP, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP1-80695
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-52553
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-56413
Species: Hu
Applications: ICC/IF, IP, WB
AF4888
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB8306
Species: Hu
Applications: IHC, WB
NBP2-19557
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
DTM100
Species: Hu
Applications: ELISA
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB

Publications for Rif1 Protein (NBP2-47303PEP) (0)

There are no publications for Rif1 Protein (NBP2-47303PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rif1 Protein (NBP2-47303PEP) (0)

There are no reviews for Rif1 Protein (NBP2-47303PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rif1 Protein (NBP2-47303PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rif1 Products

Array NBP2-47303PEP

Blogs on Rif1.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rif1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RIF1