Home » Rif1 » Rif1 Proteins » Rif1 Recombinant Protein Antigen

Rif1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Rif1 Protein (NBP2-47302PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Rif1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIF1.

Source: E.coli

Amino Acid Sequence: FLPKAKQREGTFSKSDSEKIVNGTKRSSRRAGKAEQTGNKRSKPLMRSEPEKNTEESVEGIVVLENNPPGLLNQTECVSDNQVHLSESTMEHD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RIF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47302.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Rif1 Recombinant Protein Antigen

  • DKFZp434D1026
  • DKFZp781N1478
  • FLJ10599
  • FLJ12870
  • RAP1 interacting factor homolog (yeast)
  • Rap1-interacting factor 1 homolog
  • telomere-associated protein RIF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TERF2IP Antibody
NB100-292
Western Blot: TERF2IP Antibody [NB100-292] - Detection of Human RAP1 by Western Blot. Samples: Whole cell lysate (15 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RAP1 antibody NB100-292 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: TERF2IP Antibody [NB100-292] - Sections of human lung carcinoma.~~ Antibody: Affinity purified rabbit anti-RAP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Immunoprecipitation: TERF2IP Antibody [NB100-292] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinitypurified rabbit anti-RAP1 antibody used for IP at 6 ug per reaction. RAP1 was also immunoprecipitated by a previous lot of this antibody and rabbit anti-RAP1 antibody. For blotting immunoprecipitated RAP1, was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(19 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
RAP1A Antibody
(1D4-1A3)
NBP2-22527
Western Blot: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of 25 ug of various whole cell lysate per well.
Immunocytochemistry/Immunofluorescence: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 (green) in HeLa cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% BSA/TBST for 15 minutes at room temperature. Cells were probed with a Rap1 monoclonal antibody at a dilution of 1:100 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis showing staining in the cytoplasm and membrane of human colon carcinoma (right) compared to a negative control without primary antibody (left).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Rabex5 Antibody
NBP1-49938
Western Blot: Rabex5 Antibody [NBP1-49938] - Detection of Human and Mouse RABGEF1 by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-RABGEF1 antibody used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. RABGEF1 was also immunoprecipitated by rabbit anti-RABGEF1 antibody which recognizes a downstream epitope. For blotting immunoprecipitated RABGEF1 was used. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).
Immunohistochemistry-Paraffin: Rabex5 Antibody [NBP1-49938] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RABGEF1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: WB, IHC, IHC-P, IP
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using ATM antibody [NB100-104]. Theoretical molecular weight 351 kDa.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone with ATM Antibody [NB100-104].
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton X-100. Then cells were incubated with ATM Antibody [NB100-104] at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(88 Publications)
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
ETV6/Tel Antibody
NBP1-80695
Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell lines U2OS and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: ETV6/Tel Antibody [NBP1-80695] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RhoF Antibody
(1D4B6)
NBP2-52553
Western Blot: RhoF Antibody (1D4B6) [NBP2-52553] - Analysis using RHOF mAb against human RHOF (AA: 1-84) recombinant protein. (Expected MW is 34.9 kDa)
Flow Cytometry: RhoF Antibody (1D4B6) [NBP2-52553] - Analysis of Hela cells using RHOF mouse mAb (green) and negative control (red).
Western Blot: RhoF Antibody (1D4B6) [NBP2-52553] - Analysis using RHOF mAb against HEK293 (1) and RHOF (AA: 1-84)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NGFI-B
alpha/Nur77/NR4A1 Ant
NB100-56745
Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - Analysis of Nur77 (Nak-1) in 15 ugs of NIH3T3 cell lysate using Nur77 antibody at 1:500 dilution
Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-NGFI-B alpha at 5 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - Antibody tested in Jurkat cells at a 1:50 dilution against DyLight 488 (Green). Alpha tubulin and nuclei were counterstained against DyLight 568 (Red) and DAPI (Blue), respectively.
(3 Reviews)
(19 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP
RNF34 Antibody
NBP2-56413
Western Blot: RNF34 Antibody [NBP2-56413] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: RNF34 Antibody [NBP2-56413] - Staining of human cell line CACO-2 shows localization to nuclear bodies. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IP
CLEC10A/CD301
Antibody (125A10.03)
DDX0010P-100
Immunohistochemistry: CLEC10A/CD301 Antibody (125A10.03) [DDX0010P-100] - IHC staining of lungcryosectionwith 125A10.03
Flow Cytometry: CLEC10A/CD301 Antibody (125A10.03) [DDX0010P-100] - FACS analysisof monocyte-derivedDCs (GM+IL4) stained with125A10.03+ goat anti-mouse FITC
(4 Publications)
Species: Hu, Ca
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, Flow-CS
ISCU Antibody
NBP2-14998
Western Blot: ISCU Antibody [NBP2-14998] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with ISCU antibody [N1C3] diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ISCU Antibody [NBP2-14998] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: ISCU protein stained by ISCU antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: ISCU Antibody [NBP2-14998] - Paraffin-embedded mouse muscle. ISCU antibody [N1C3] dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NOA1 Antibody
NBP1-81773
Western Blot: NOA1 Antibody [NBP1-81773] - Analysis using Anti-NOA1 antibody NBP1-81773 (A) shows similar pattern to independent antibody NBP1-81772 (B).
Immunocytochemistry/Immunofluorescence: NOA1 Antibody [NBP1-81773] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: NOA1 Antibody [NBP1-81773] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATR Antibody (2B5)
NB100-308
Western Blot: ATR Antibody (2B5) [NB100-308] - Human Raji whole cell extract. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
(18 Publications)
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
INSL3 Antibody
NBP1-81223
Immunohistochemistry-Paraffin: INSL3 Antibody [NBP1-81223] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: INSL3 Antibody [NBP1-81223] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: INSL3 Antibody [NBP1-81223] - Staining in human testis and endometrium tissues using anti-INSL3 antibody. Corresponding INSL3 RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TRF-2 Antibody
(4A794.15)
NB100-56506
Simple Western: TRF-2 Antibody (4A794.15) [NB100-56506] - Image shows a specific band for TRF2 in 1.0 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Immunocytochemistry/Immunofluorescence: TRF-2 Antibody (4A794.15) [NB100-56506] - Localization of candidate RNAs at telomeres. Localization of NEAT1 at telomeres in human U-2 OS cells. Cells were fixed and sequentially incubated with Abs against TRF-2 and AlexaFluor 488-conjugated anti-mouse IgG. Subsequently, the cells were hybridized with the RNA probes and subjected to fluorescence microscopy. Three different cells are shown. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0123387), licensed under a CC-BY licence.
Western Blot: TRF-2 Antibody (4A794.15) [NB100-56506] - Analysis in human Jurkat cell lysate at 2 ug/mL. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used.
(1 Review)
(101 Publications)
Species: Hu, Mu, Rt, Ma, Ma
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
TIMP-1 [HRP]
DTM100
(1 Review)
(81 Publications)
Species: Hu
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - YM155 significantly reduced tumorsphere formation and inhibited EGFR autophosphorylation and G9a expression. YM155 is reported to suppress cancer stemness; therefore, we used this compound to investigate the cellular mechanism of tumorsphere formation. To compare the cytotoxic capacity of YM155 against tumorsphere formation and parental cell lines, YM155 was applied to HCC827 and A549 cells in the stemness cultured or integrated medium. (F) Moreover, YM155 inhibited EGFR autophosphorylation in A549-derived tumorspheres and reduced Oct4 expression. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0182149) licensed under a CC-BY licence.
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(2 Reviews)
(16 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC

Publications for Rif1 Protein (NBP2-47302PEP) (0)

There are no publications for Rif1 Protein (NBP2-47302PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rif1 Protein (NBP2-47302PEP) (0)

There are no reviews for Rif1 Protein (NBP2-47302PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rif1 Protein (NBP2-47302PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Rif1 Products

Array NBP2-47302PEP

Bioinformatics Tool for Rif1 Protein (NBP2-47302PEP)

Discover related pathways, diseases and genes to Rif1 Protein (NBP2-47302PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rif1 Protein (NBP2-47302PEP)

Discover more about diseases related to Rif1 Protein (NBP2-47302PEP).
 

Pathways for Rif1 Protein (NBP2-47302PEP)

View related products by pathway.

PTMs for Rif1 Protein (NBP2-47302PEP)

Learn more about PTMs related to Rif1 Protein (NBP2-47302PEP).

Blogs on Rif1.

Check out the latest blog posts on Rif1.
The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Customers Who Bought This Also Bought

Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using ATM antibody [NB100-104]. Theoretical molecular weight 351 kDa.
ATM Antibody
NB100-104
Simple Western: TRF-2 Antibody (4A794.15) [NB100-56506] - Image shows a specific band for TRF2 in 1.0 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
TRF-2 Antibody (4A794.15)
NB100-56506

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rif1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RIF1