RHOT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RHOT2 Antibody [NBP1-88981] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88981] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHOT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RHOT2 Protein (NBP1-88981PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHOT2 Antibody

  • ARHT2
  • C16orf39
  • chromosome 16 open reading frame 39
  • EC 3.6.5
  • EC 3.6.5.-
  • hMiro-2
  • MIRO-2mitochondrial Rho 2
  • mitochondrial Rho GTPase 2
  • Ras homolog gene family member T2
  • ras homolog gene family, member T2
  • RASL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59021
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-56761
Species: Hu
Applications: WB
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-54955
Species: Hu
Applications: ICC/IF, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
BC100-494
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88981
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RHOT2 Antibody (NBP1-88981) (0)

There are no publications for RHOT2 Antibody (NBP1-88981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOT2 Antibody (NBP1-88981) (0)

There are no reviews for RHOT2 Antibody (NBP1-88981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RHOT2 Antibody (NBP1-88981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHOT2 Products

Bioinformatics Tool for RHOT2 Antibody (NBP1-88981)

Discover related pathways, diseases and genes to RHOT2 Antibody (NBP1-88981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOT2 Antibody (NBP1-88981)

Discover more about diseases related to RHOT2 Antibody (NBP1-88981).
 

Pathways for RHOT2 Antibody (NBP1-88981)

View related products by pathway.

PTMs for RHOT2 Antibody (NBP1-88981)

Learn more about PTMs related to RHOT2 Antibody (NBP1-88981).
 

Research Areas for RHOT2 Antibody (NBP1-88981)

Find related products by research area.

Blogs on RHOT2

There are no specific blogs for RHOT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHOT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOT2