RhoJ Antibody (1E4) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse RhoJ Antibody (1E4) - Azide and BSA Free (H00057381-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-RhoJ Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
RHOJ (AAH62575, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII |
| Specificity |
RHOJ - ras homolog gene family, member J |
| Isotype |
IgG1 Lambda |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RHOJ |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Functional
- Immunocytochemistry/ Immunofluorescence 1:10-1:500
- Immunohistochemistry
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Publications |
|
Reactivity Notes
Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RhoJ Antibody (1E4) - Azide and BSA Free
Background
ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Publications for RhoJ Antibody (H00057381-M01)(6)
Showing Publications 1 -
6 of 6.
| Publications using H00057381-M01 |
Applications |
Species |
| Sohail J, Jose O, Linh V et al. Structure-based design of CDC42 effector interaction inhibitors for the treatment of cancer. Cell Rep. 2022-04-05 [PMID: 35385746] |
|
|
| Mei W, Chengfei Z, Qian Z et al. RhoJ facilitates angiogenesis in glioblastoma via JNK/VEGFR2 mediated activation of PAK and ERK signaling pathways. Int J Biol Sci. 2022-01-01 [PMID: 35173528] |
|
|
| Liu S, Li H, Xia L et al. Anti-RhoJ antibody functionalized Au@I nanoparticles as CT-guided tumor vessel-targeting radiosensitizers in patient-derived tumor xenograft model. Biomaterials 2017-06-23 [PMID: 28666098] |
|
|
| Kim C, Yang H, Park I et al. Rho GTPase RhoJ is Associated with Gastric Cancer Progression and Metastasis. Journal of Cancer 2016-07-08 [PMID: 27471571] |
|
|
| Ho H, Aruri J, Kapadia R et al. RhoJ and Pak Kinases Regulate Melanoma Chemoresistance by Suppressing Pathways that Sense DNA Damage. Cancer Res. 2012-09-12 [PMID: 22971344] |
|
|
| Fukushima Y, Okada M, Kataoka H et al. Sema3E-PlexinD1 signaling selectively suppresses disoriented angiogenesis in ischemic retinopathy in mice. J Clin Invest. 2011-04-18 [PMID: 21505259] |
|
|
Reviews for RhoJ Antibody (H00057381-M01) (0)
There are no reviews for RhoJ Antibody (H00057381-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RhoJ Antibody (H00057381-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RhoJ Products
Research Areas for RhoJ Antibody (H00057381-M01)
Find related products by research area.
|
Blogs on RhoJ