Recombinant Human RhoH Protein

Images

 
SDS-Page: Recombinant Human RhoH Protein [H00000399-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RhoH Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 191 of Human RHOH full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVVTQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RHOH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RhoH Protein

  • ras homolog gene family, member H
  • translocation three four

Background

RHOH( AAH14261, 1 a.a. - 192 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-07799
Species: Hu
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
AF4245
Species: Hu
Applications: WB, IP
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for RhoH Recombinant Protein (H00000399-P01) (0)

There are no publications for RhoH Recombinant Protein (H00000399-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoH Recombinant Protein (H00000399-P01) (0)

There are no reviews for RhoH Recombinant Protein (H00000399-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoH Recombinant Protein (H00000399-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoH Products

Bioinformatics Tool for RhoH Recombinant Protein (H00000399-P01)

Discover related pathways, diseases and genes to RhoH Recombinant Protein (H00000399-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoH Recombinant Protein (H00000399-P01)

Discover more about diseases related to RhoH Recombinant Protein (H00000399-P01).
 

Pathways for RhoH Recombinant Protein (H00000399-P01)

View related products by pathway.

PTMs for RhoH Recombinant Protein (H00000399-P01)

Learn more about PTMs related to RhoH Recombinant Protein (H00000399-P01).
 

Research Areas for RhoH Recombinant Protein (H00000399-P01)

Find related products by research area.

Blogs on RhoH

There are no specific blogs for RhoH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
RhoH Antibody
NBP1-88816
ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RhoH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOH