RhoH Recombinant Protein Antigen

Images

 
There are currently no images for RhoH Protein (NBP1-88816PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RhoH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOH.

Source: E. coli

Amino Acid Sequence: KWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88816.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RhoH Recombinant Protein Antigen

  • ras homolog gene family, member H
  • translocation three four

Background

The Rho subfamily of small GTP-binding proteins mediates many fundamental cellular functions. The commonly studied members (Rho, Rac, and CDC42) regulate actin reorganization and affect diverse cellular responses, including adhesion, cytokinesis, and motility. RhoH, also known as TTF (Translocation Three Four), Rho-related GTP-binding protein and ras homolog gene family member H, is unlike most other small G proteins. Most small G proteins are expressed ubiquitously, however, Rho H is expressed only in hemopoietic cells and tissues. Translocations and a high frequency of Rho H mutation have been detected in primary lymphoma cells. Rho H expression has also been observed in activated neutrophils. RhoH is GTPase deficient, remaining in a GTP-bound activated state without cycling. Rho H may be involved in the functional differentiation of T cells and in cytoskeleton organization. The RhoH/TTF (ARHH) gene maps to chromosome 4p13 and encodes a 191 -amino acid polypeptide.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
NBP3-27122
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-77031
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB3487
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
NBP2-67528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81734
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB

Publications for RhoH Protein (NBP1-88816PEP) (0)

There are no publications for RhoH Protein (NBP1-88816PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoH Protein (NBP1-88816PEP) (0)

There are no reviews for RhoH Protein (NBP1-88816PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RhoH Protein (NBP1-88816PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoH Products

Research Areas for RhoH Protein (NBP1-88816PEP)

Find related products by research area.

Blogs on RhoH

There are no specific blogs for RhoH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RhoH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOH