RHOBTB1 Antibody

Images

 
Western Blot: RHOBTB1 Antibody [NBP1-81485] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: RHOBTB1 Antibody [NBP1-81485] - Staining of human cell line U-2 OS shows positivity in cytoplasm & cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: RHOBTB1 Antibody [NBP1-81485] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

RHOBTB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOBTB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
RHOBTB1 Protein (NBP1-81485PEP)

Alternate Names for RHOBTB1 Antibody

  • KIAA0740MGC33059
  • MGC33841
  • Rho-related BTB domain containing 1
  • rho-related BTB domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32576
Species: Hu
Applications: IHC, IHC-P
H00022836-Q01
Species: Hu
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-32509
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59021
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
H00005880-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-59723
Species: Hu, Po
Applications: WB, ICC/IF
NB100-58788
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-45477
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3429
Species: Hu
Applications: WB
NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88816
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88832
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6618
Species: Hu, Mu
Applications: WB

Publications for RHOBTB1 Antibody (NBP1-81485) (0)

There are no publications for RHOBTB1 Antibody (NBP1-81485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOBTB1 Antibody (NBP1-81485) (0)

There are no reviews for RHOBTB1 Antibody (NBP1-81485). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RHOBTB1 Antibody (NBP1-81485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHOBTB1 Antibody Products

Related Products by Gene

Bioinformatics Tool for RHOBTB1 Antibody (NBP1-81485)

Discover related pathways, diseases and genes to RHOBTB1 Antibody (NBP1-81485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOBTB1 Antibody (NBP1-81485)

Discover more about diseases related to RHOBTB1 Antibody (NBP1-81485).
 

Pathways for RHOBTB1 Antibody (NBP1-81485)

View related products by pathway.

PTMs for RHOBTB1 Antibody (NBP1-81485)

Learn more about PTMs related to RHOBTB1 Antibody (NBP1-81485).

Blogs on RHOBTB1

There are no specific blogs for RHOBTB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RHOBTB1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81485 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought