RHOBTB1 Antibody


Western Blot: RHOBTB1 Antibody [NBP1-81485] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: RHOBTB1 Antibody [NBP1-81485] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: RHOBTB1 Antibody [NBP1-81485] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RHOBTB1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:TQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEM
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
RHOBTB1 Protein (NBP1-81485PEP)

Alternate Names for RHOBTB1 Antibody

  • KIAA0740MGC33059
  • MGC33841
  • Rho-related BTB domain containing 1
  • rho-related BTB domain-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Po
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for RHOBTB1 Antibody (NBP1-81485) (0)

There are no publications for RHOBTB1 Antibody (NBP1-81485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOBTB1 Antibody (NBP1-81485) (0)

There are no reviews for RHOBTB1 Antibody (NBP1-81485). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RHOBTB1 Antibody (NBP1-81485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RHOBTB1 Antibody Products

Related Products by Gene

Bioinformatics Tool for RHOBTB1 Antibody (NBP1-81485)

Discover related pathways, diseases and genes to RHOBTB1 Antibody (NBP1-81485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOBTB1 Antibody (NBP1-81485)

Discover more about diseases related to RHOBTB1 Antibody (NBP1-81485).

Pathways for RHOBTB1 Antibody (NBP1-81485)

View related products by pathway.

PTMs for RHOBTB1 Antibody (NBP1-81485)

Learn more about PTMs related to RHOBTB1 Antibody (NBP1-81485).

Blogs on RHOBTB1

There are no specific blogs for RHOBTB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our RHOBTB1 Antibody and receive a gift card or discount.


Gene Symbol RHOBTB1

Customers Who Bought This Also Bought