RHOBTB2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RHOBTB2 Antibody [NBP2-32576] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.

Immunohistochemistry-Paraffin: RHOBTB2 Antibody [NBP2-32576] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RHOBTB2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOBTB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RHOBTB2 Protein (NBP2-32576PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RHOBTB2 Antibody - BSA Free

• DBC2KIAA0717Deleted in breast cancer 2 gene protein
• p83
• Rho-related BTB domain containing 2
• rho-related BTB domain-containing protein 2

Background

RHOBTB2 (Rho-Related BTB Domain Containing 2) is a tumor suppressor for some forms of breast cancer and may have a role in protein transport. RHOBTB2 is known to have interactions with KDM5B, ARHGAP35, RAC2, RHOB and RHOBTB1. RHOBTB2 has been studied in relation to breast cancer, sporadic breast cancer, familial breast cancer and gastric cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHOBTB2