RHOBTB2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RHOBTB2 Antibody [NBP2-32576] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: RHOBTB2 Antibody [NBP2-32576] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHOBTB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOBTB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RHOBTB2 Protein (NBP2-32576PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHOBTB2 Antibody

  • DBC2KIAA0717Deleted in breast cancer 2 gene protein
  • p83
  • Rho-related BTB domain containing 2
  • rho-related BTB domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-81485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15353
Species: Hu
NBP1-83908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-52553
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-59021
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14362
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31398
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89189
Species: Hu
Applications: IHC, IHC-P

Publications for RHOBTB2 Antibody (NBP2-32576) (0)

There are no publications for RHOBTB2 Antibody (NBP2-32576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOBTB2 Antibody (NBP2-32576) (0)

There are no reviews for RHOBTB2 Antibody (NBP2-32576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RHOBTB2 Antibody (NBP2-32576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHOBTB2 Products

Bioinformatics Tool for RHOBTB2 Antibody (NBP2-32576)

Discover related pathways, diseases and genes to RHOBTB2 Antibody (NBP2-32576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOBTB2 Antibody (NBP2-32576)

Discover more about diseases related to RHOBTB2 Antibody (NBP2-32576).
 

Pathways for RHOBTB2 Antibody (NBP2-32576)

View related products by pathway.

PTMs for RHOBTB2 Antibody (NBP2-32576)

Learn more about PTMs related to RHOBTB2 Antibody (NBP2-32576).
 

Research Areas for RHOBTB2 Antibody (NBP2-32576)

Find related products by research area.

Blogs on RHOBTB2

There are no specific blogs for RHOBTB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHOBTB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOBTB2