RHOBTB2 Antibody


Immunocytochemistry/ Immunofluorescence: RHOBTB2 Antibody [NBP2-32576] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: RHOBTB2 Antibody [NBP2-32576] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RHOBTB2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
Specificity of human RHOBTB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RHOBTB2 Protein (NBP2-32576PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RHOBTB2 Antibody

  • DBC2KIAA0717Deleted in breast cancer 2 gene protein
  • p83
  • Rho-related BTB domain containing 2
  • rho-related BTB domain-containing protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for RHOBTB2 Antibody (NBP2-32576) (0)

There are no publications for RHOBTB2 Antibody (NBP2-32576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOBTB2 Antibody (NBP2-32576) (0)

There are no reviews for RHOBTB2 Antibody (NBP2-32576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RHOBTB2 Antibody (NBP2-32576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RHOBTB2 Products

Bioinformatics Tool for RHOBTB2 Antibody (NBP2-32576)

Discover related pathways, diseases and genes to RHOBTB2 Antibody (NBP2-32576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOBTB2 Antibody (NBP2-32576)

Discover more about diseases related to RHOBTB2 Antibody (NBP2-32576).

Pathways for RHOBTB2 Antibody (NBP2-32576)

View related products by pathway.

PTMs for RHOBTB2 Antibody (NBP2-32576)

Learn more about PTMs related to RHOBTB2 Antibody (NBP2-32576).

Research Areas for RHOBTB2 Antibody (NBP2-32576)

Find related products by research area.

Blogs on RHOBTB2

There are no specific blogs for RHOBTB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RHOBTB2 Antibody and receive a gift card or discount.


Gene Symbol RHOBTB2