RHOBTB1 Antibody - BSA Free

Western Blot: RHOBTB1 Antibody [NBP1-58908] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 4.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Immunohistochemistry-Paraffin: RHOBTB1 Antibody [NBP1-58908] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Western Blot: RHOBTB1 Antibody [NBP1-58908] - Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RHOBTB1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RHOBTB1(Rho-related BTB domain containing 1) The peptide sequence was selected from the middle region of RHOBTB1. Peptide sequence DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOBTB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RHOBTB1 Antibody - BSA Free

• KIAA0740MGC33059
• MGC33841
• Rho-related BTB domain containing 1
• rho-related BTB domain-containing protein 1

Background

RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate transcriptional splice variants have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHOBTB1
• Uniprot:
  • O94844(Human)