RHBDL2 Antibody (2H1)

Images

 
Sandwich ELISA: RHBDL2 Antibody (2H1) [H00054933-M02] - Detection limit for recombinant GST tagged RHBDL2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RHBDL2 Antibody (2H1) Summary

Immunogen
RHBDL2 (NP_060291.2, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP
Specificity
RHBDL2 - rhomboid, veinlet-like 2 (Drosophila) (2H1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RHBDL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RHBDL2 Antibody (2H1)

  • EC 3.4.21.105
  • FLJ20435
  • MGC16997
  • rhomboid (veinlet, Drosophila)-like 2
  • rhomboid protease 2
  • rhomboid, veinlet-like 2 (Drosophila)
  • Rhomboid-like protein 2
  • rhomboid-related protein 2
  • RRP2

Background

The protein encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF3894
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP2-84246
Species: Hu
Applications: WB
NBP1-85338
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
236-EG
Species: Hu
Applications: BA
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87804
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57299
Species: Hu
Applications: IHC, IHC-P, WB
AF3034
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-30951
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94068
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85092
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
H00051542-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP1-85076
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00054933-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for RHBDL2 Antibody (H00054933-M02) (0)

There are no publications for RHBDL2 Antibody (H00054933-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBDL2 Antibody (H00054933-M02) (0)

There are no reviews for RHBDL2 Antibody (H00054933-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHBDL2 Antibody (H00054933-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHBDL2 Products

Bioinformatics Tool for RHBDL2 Antibody (H00054933-M02)

Discover related pathways, diseases and genes to RHBDL2 Antibody (H00054933-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBDL2 Antibody (H00054933-M02)

Discover more about diseases related to RHBDL2 Antibody (H00054933-M02).
 

Pathways for RHBDL2 Antibody (H00054933-M02)

View related products by pathway.

PTMs for RHBDL2 Antibody (H00054933-M02)

Learn more about PTMs related to RHBDL2 Antibody (H00054933-M02).

Blogs on RHBDL2

There are no specific blogs for RHBDL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHBDL2 Antibody (2H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBDL2
Entrez
Uniprot