RHBDL2 Antibody (2H1)

Sandwich ELISA: RHBDL2 Antibody (2H1) [H00054933-M02] - Detection limit for recombinant GST tagged RHBDL2 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2H1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

RHBDL2 Antibody (2H1) Summary

• Immunogen: RHBDL2 (NP_060291.2, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP
• Specificity: RHBDL2 - rhomboid, veinlet-like 2 (Drosophila) (2H1)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RHBDL2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RHBDL2 Antibody (2H1)

• EC 3.4.21.105
• FLJ20435
• MGC16997
• rhomboid (veinlet, Drosophila)-like 2
• rhomboid protease 2
• rhomboid, veinlet-like 2 (Drosophila)
• Rhomboid-like protein 2
• rhomboid-related protein 2
• RRP2

Background

The protein encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDL2
• Entrez:
  • 54933(Human)
• Uniprot:
  • NP_060291(Human)