RGM-A Antibody

Immunocytochemistry/Immunofluorescence: RGM-A Antibody [NBP2-58461] - Staining of human cell line RH-30 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

RGM-A Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFG
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RGMA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RGM-A Antibody

• RGM domain family member A
• RGM domain family, member A
• RGMA
• RGM-A
• RGMrepulsive guidance molecule A

Background

The Repulsive Guidance Molecule A gene encodes a member of the repulsive guidance molecule family. The encoded protein is aglycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing andadult central nervous system. This protein may

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RGMA