RFPL4A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RFPL4A Antibody [NBP2-13222] - Staining of human cell line U-2 OS shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: RFPL4A Antibody [NBP2-13222] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFPL4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFPL4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFPL4A Protein (NBP2-13222PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RFPL4A Antibody

  • ret finger protein-like 4A
  • RFPL4
  • RING finger protein 210
  • RNF210ret finger protein-like 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-90657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-93938
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00344018-P01
Species: Hu
NBP2-20453
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56883
Species: Hu
Applications: ICC/IF
5096-BM
Species: Hu
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-46193
Species: Hu
Applications: WB, IHC
NBP2-37467
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RFPL4A Antibody (NBP2-13222) (0)

There are no publications for RFPL4A Antibody (NBP2-13222).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFPL4A Antibody (NBP2-13222) (0)

There are no reviews for RFPL4A Antibody (NBP2-13222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RFPL4A Antibody (NBP2-13222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFPL4A Products

RFPL4A NBP2-13222

Bioinformatics Tool for RFPL4A Antibody (NBP2-13222)

Discover related pathways, diseases and genes to RFPL4A Antibody (NBP2-13222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RFPL4A

There are no specific blogs for RFPL4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFPL4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFPL4A