RFNG Antibody (6C7)

Images

 
Western Blot: RFNG Antibody (6C7) [H00005986-M08] - Analysis of RFNG expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: RFNG Antibody (6C7) [H00005986-M08] - Analysis of monoclonal antibody to RFNG on HepG2 cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RFNG Antibody (6C7) Summary

Immunogen
RFNG (AAC51359.1, 82 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
Specificity
RFNG - radical fringe homolog (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RFNG
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFNG Antibody (6C7)

  • beta-1,3-N-acetylglucosaminyltransferase radical fringe
  • EC 2.4.1.222
  • O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • radical fringe (Drosophila) homolog
  • radical fringe homolog (Drosophila)
  • radical fringe homolog
  • RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • RFNG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
AF6355
Species: Hu
Applications: WB, IP
NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
3008-WN/CF
Species: Hu
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3444
Species: Hu
Applications: WB
AF1620
Species: Mu
Applications: WB, IHC
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RFNG Antibody (H00005986-M08) (0)

There are no publications for RFNG Antibody (H00005986-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFNG Antibody (H00005986-M08) (0)

There are no reviews for RFNG Antibody (H00005986-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RFNG Antibody (H00005986-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFNG Products

Bioinformatics Tool for RFNG Antibody (H00005986-M08)

Discover related pathways, diseases and genes to RFNG Antibody (H00005986-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFNG Antibody (H00005986-M08)

Discover more about diseases related to RFNG Antibody (H00005986-M08).
 

Pathways for RFNG Antibody (H00005986-M08)

View related products by pathway.

PTMs for RFNG Antibody (H00005986-M08)

Learn more about PTMs related to RFNG Antibody (H00005986-M08).
 

Research Areas for RFNG Antibody (H00005986-M08)

Find related products by research area.

Blogs on RFNG

There are no specific blogs for RFNG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFNG Antibody (6C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol RFNG
Entrez
OMIM