MFNG Antibody - BSA Free

Western Blot: Manic Fringe Antibody [NBP1-79288] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MFNG Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human MFNG (NP_002396). Peptide sequence MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFNG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MFNG Antibody - BSA Free

• beta-1,3-N-acetylglucosaminyltransferase manic fringe
• EC 2.4.1.222
• manic fringe (Drosophila) homolog
• manic fringe homolog (Drosophila)
• MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
• MFNG
• O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Background

MFNG, also known as Beta-1,3-N-acetylglucosaminyltransferase manic fringe, has 2 isoforms, a 321 amino acid isoform that is 36 kDa and a 307 amino acid isoform that is 35 kDa, Golgi apparatus membrane subcellular location, participates in the elongation of O-linked ligands to activate Notch signaling and has fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity. Studies on this protein have shown a relationship with the following diseases and disorders: alagille syndrome, basal cell carcinoma, hepatitis b, psoriasis, hepatitis, and carcinoma. This protein has also been shown to have interactions with NOTCH2, JAG1, JAG2, DLL1, NOTCH1, ITGA3, LHX2, and NOTCH3 in Notch signaling pathway, Pre-NOTCH Expression and Processing, Pre-NOTCH Processing in Golgi, Signal Transduction, Delta-Notch Signaling Pathway, other types of O-glycan biosynthesis, and Development Notch Signaling Pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MFNG Antibody (NBP1-79288)(1)

Publication using NBP1-79288

• Mugisha S, Di X, Wen D et al. Upregulated GATA3/miR205-5p Axis Inhibits MFNG Transcription and Reduces the Malignancy of Triple-Negative Breast Cancer Cancers 2022-06-22 [PMID: 35804829] (WB, IHC-P, Human)

Bioinformatics

• Gene Symbol: MFNG
• Entrez:
  • 4242(Human)
• Uniprot:
  • O00587(Human)