Rffl Antibody (3A4)

Images

 
Western Blot: Rffl Antibody (3A4) [H00117584-M01] - Analysis of RFFL expression in transfected 293T cell line by RFFL monoclonal antibody (M01), clone 3A4.Lane 1: RFFL transfected lysate(36.6 KDa).Lane 2: ...read more
Western Blot: Rffl Antibody (3A4) [H00117584-M01] - Analysis of RFFL over-expressed 293 cell line, cotransfected with RFFL Validated Chimera RNAi ( Cat # H00117584-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: Rffl Antibody (3A4) [H00117584-M01] - Detection limit for recombinant GST tagged RFFL is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KD
Clone
3A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rffl Antibody (3A4) Summary

Immunogen
RFFL (NP_001017368, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQRE
Specificity
RFFL - rififylin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RFFL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA and RNAi Validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rffl Antibody (3A4)

  • CARP-2
  • Caspase regulator CARP2
  • Caspases-8 and -10-associated RING finger protein 2
  • E3 ubiquitin-protein ligase rififylin
  • EC 6.3.2
  • EC 6.3.2.-
  • Fring
  • FYVE-RING finger protein Sakura
  • rififylin
  • ring finger and FYVE-like domain containing 1
  • RING finger and FYVE-like domain-containing protein 1
  • RING finger protein 189
  • RING finger protein 34-like
  • RNF189CARP2
  • RNF34LFRING

Background

RFFL, also known as Rififylin, RING finger and FYVE-like domain-containing protein 1, FYVE-RING finger protein, Sakura, Fring, Caspases-8 and -10-associated RING finger protein 2, CARP-2, Caspase regulator CARP2, RING finger protein 189 and RING finger protein 34-like, is a novel modulator of NF-kB activation. RFFL possesses E3 ubiquitin protein ligase activity and has been shown to regulate the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL also possesses anti-apoptotic activity and may bind phosphatidylinositol phosphates. RFFL is a membrane bound cytoplasmic protein that is expressed ubiquitously. RFFL can be detected in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes and is rapidly degraded after stimulation with TNFSF10, and probably by caspases. Multiple transcript variants have been detected for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56413
Species: Hu
Applications: ICC/IF, IP, WB
NB500-186
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBL1-08611
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF7287
Species: Hu, Mu
Applications: IHC, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-82025
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
375-TL
Species: Hu
Applications: BA
DRT100
Species: Hu
Applications: ELISA
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
H00117584-M01
Species: Hu
Applications: WB, ELISA, KD

Publications for Rffl Antibody (H00117584-M01) (0)

There are no publications for Rffl Antibody (H00117584-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rffl Antibody (H00117584-M01) (0)

There are no reviews for Rffl Antibody (H00117584-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rffl Antibody (H00117584-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rffl Products

Diseases for Rffl Antibody (H00117584-M01)

Discover more about diseases related to Rffl Antibody (H00117584-M01).
 

Pathways for Rffl Antibody (H00117584-M01)

View related products by pathway.

PTMs for Rffl Antibody (H00117584-M01)

Learn more about PTMs related to Rffl Antibody (H00117584-M01).

Blogs on Rffl

There are no specific blogs for Rffl, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rffl Antibody (3A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RFFL
Entrez
Uniprot