Recombinant Human RFC4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RFC4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-363 of Human RFC4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RFC4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RFC4 Protein

  • A1 37 kDa subunit
  • A1
  • Activator 1 37 kDa subunit
  • Activator 1 subunit 4
  • MGC27291
  • replication factor C (activator 1) 4, 37kDa
  • Replication factor C 37 kDa subunit
  • replication factor C subunit 4
  • RFC 37 kDa subunit
  • RF-C 37 kDa subunit
  • RFC37replication factor C (activator 1) 4 (37kD)

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005984-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RFC4 Recombinant Protein (H00005984-P01) (0)

There are no publications for RFC4 Recombinant Protein (H00005984-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC4 Recombinant Protein (H00005984-P01) (0)

There are no reviews for RFC4 Recombinant Protein (H00005984-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFC4 Recombinant Protein (H00005984-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFC4 Products

Bioinformatics Tool for RFC4 Recombinant Protein (H00005984-P01)

Discover related pathways, diseases and genes to RFC4 Recombinant Protein (H00005984-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC4 Recombinant Protein (H00005984-P01)

Discover more about diseases related to RFC4 Recombinant Protein (H00005984-P01).
 

Pathways for RFC4 Recombinant Protein (H00005984-P01)

View related products by pathway.

PTMs for RFC4 Recombinant Protein (H00005984-P01)

Learn more about PTMs related to RFC4 Recombinant Protein (H00005984-P01).
 

Research Areas for RFC4 Recombinant Protein (H00005984-P01)

Find related products by research area.

Blogs on RFC4

There are no specific blogs for RFC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RFC4 Antibody
NB100-233

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RFC4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC4