Recombinant Human RFC4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human RFC4 Protein [H00005984-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human RFC4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 254-363 of Human RFC4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RFC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RFC4 GST (N-Term) Protein

  • A1 37 kDa subunit
  • A1
  • Activator 1 37 kDa subunit
  • Activator 1 subunit 4
  • MGC27291
  • replication factor C (activator 1) 4, 37kDa
  • Replication factor C 37 kDa subunit
  • replication factor C subunit 4
  • RFC 37 kDa subunit
  • RF-C 37 kDa subunit
  • RFC37replication factor C (activator 1) 4 (37kD)

Background

RFC4 - replication factor C (activator 1) 4, 37kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-06290
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF1936
Species: Hu
Applications: IP, WB
210-TA
Species: Hu
Applications: BA
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-88996
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB

Publications for RFC4 Partial Recombinant Protein (H00005984-Q01) (0)

There are no publications for RFC4 Partial Recombinant Protein (H00005984-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC4 Partial Recombinant Protein (H00005984-Q01) (0)

There are no reviews for RFC4 Partial Recombinant Protein (H00005984-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFC4 Partial Recombinant Protein (H00005984-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFC4 Products

Bioinformatics Tool for RFC4 Partial Recombinant Protein (H00005984-Q01)

Discover related pathways, diseases and genes to RFC4 Partial Recombinant Protein (H00005984-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC4 Partial Recombinant Protein (H00005984-Q01)

Discover more about diseases related to RFC4 Partial Recombinant Protein (H00005984-Q01).
 

Pathways for RFC4 Partial Recombinant Protein (H00005984-Q01)

View related products by pathway.

PTMs for RFC4 Partial Recombinant Protein (H00005984-Q01)

Learn more about PTMs related to RFC4 Partial Recombinant Protein (H00005984-Q01).
 

Research Areas for RFC4 Partial Recombinant Protein (H00005984-Q01)

Find related products by research area.

Blogs on RFC4

There are no specific blogs for RFC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RFC4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC4