![Western Blot: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize/Rev-erb-beta-NR1D2-Antibody-Western-Blot-NBP2-56141-img0002.jpg "Western Blot: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NR1D2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Publication using NBP2-56141 | Applications | Species |
|---|---|---|
| He, M X, Cuoco, M S Et al. Transcriptional mediators of treatment resistance in lethal prostate cancer. Nat Med 2021-03-01 [PMID: 33664492] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NR1D2 |
![Immunocytochemistry/Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Staining of human cell line PC-3 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/Rev-erb-beta-NR1D2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56141-img0001.jpg "Immunocytochemistry/Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Staining of human cell line PC-3 shows localization to nucleoplasm.")
![Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Cancer cells from small cell carcinoma employ highly divergent regulatory program compared to adenocarcinoma cells.a,b, Gene set expression scores of single G1 cells using expression signature of NEPC18 (a) & set of genes regulated by AR17 (b). Box plots: center line, median; box limits, upper & lower quartiles; whiskers extend at most 1.5× interquartile range past upper & lower quartiles; P values from 2-sided Mann–Whitney U-test. c, Inferred activity of regulons of different transcriptional regulators. x axis, q values from comparison of inferred regulon activity in cancer cells from small cell carcinoma (n = 76) vs cancer cells from adenocarcinomas (n = 188, sampled as described in Methods) (negative values indicate regulon is less active in small cell carcinoma; two-sided Mann–Whitney U-test, median outcome of sampling iterations (Methods) w/ Bonferroni FWER correction). y axis: P values (two-sided Mann–Whitney U-test, signed as previous) from comparison of expression scores of scRNA-derived regulons in bulk RNA-seq of small cell carcinomas (n = 8) vs adenocarcinomas (n = 18) from a published cohort8. d, Regulon activity in single cells for select transcriptional regulators. e, Hierarchical clustering of bulk RNA-seq of a published cohort of prostate cancers of known histopathology18 based on expression of HOXB5, HOXB6 & NR1D2 regulons inferred from scRNA-seq. B–E correspond to different NEPC subtype labels from original publication. Expression levels of EZH2, NANOG & SOX2 shown for reference but not used in clustering (n = 34 adenocarcinoma, 15 NEPC). f, IHC staining of HOXB5, HOXB6 & NR1D2 protein levels in two prostate adenocarcinoma xenografts (LNCaP & VCaP) & four NEPC patient-derived organoids. Scale bar: 50 μm. Image collected & cropped by CiteAb from following publication (//pubmed.ncbi.nlm.nih.gov/33664492), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-56141_rabbit-polyclonal-rev-erb-beta-nr1d2-antibody-310202416121976.jpg "Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Cancer cells from small cell carcinoma employ highly divergent regulatory program compared to adenocarcinoma cells.a,b, Gene set expression scores of single G1 cells using expression signature of NEPC18 (a) & set of genes regulated by AR17 (b). Box plots: center line, median; box limits, upper & lower quartiles; whiskers extend at most 1.5× interquartile range past upper & lower quartiles; P values from 2-sided Mann–Whitney U-test. c, Inferred activity of regulons of different transcriptional regulators. x axis, q values from comparison of inferred regulon activity in cancer cells from small cell carcinoma (n = 76) vs cancer cells from adenocarcinomas (n = 188, sampled as described in Methods) (negative values indicate regulon is less active in small cell carcinoma; two-sided Mann–Whitney U-test, median outcome of sampling iterations (Methods) w/ Bonferroni FWER correction). y axis: P values (two-sided Mann–Whitney U-test, signed as previous) from comparison of expression scores of scRNA-derived regulons in bulk RNA-seq of small cell carcinomas (n = 8) vs adenocarcinomas (n = 18) from a published cohort8. d, Regulon activity in single cells for select transcriptional regulators. e, Hierarchical clustering of bulk RNA-seq of a published cohort of prostate cancers of known histopathology18 based on expression of HOXB5, HOXB6 & NR1D2 regulons inferred from scRNA-seq. B–E correspond to different NEPC subtype labels from original publication. Expression levels of EZH2, NANOG & SOX2 shown for reference but not used in clustering (n = 34 adenocarcinoma, 15 NEPC). f, IHC staining of HOXB5, HOXB6 & NR1D2 protein levels in two prostate adenocarcinoma xenografts (LNCaP & VCaP) & four NEPC patient-derived organoids. Scale bar: 50 μm. Image collected & cropped by CiteAb from following publication (//pubmed.ncbi.nlm.nih.gov/33664492), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")