Rev-erb beta/NR1D2 Antibody

Images

 
Western Blot: Rev-erb beta/NR1D2 Antibody [NBP2-47306] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-2 OS
Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-47306] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rev-erb beta/NR1D2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR1D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Rev-erb beta/NR1D2 Protein (NBP2-47306PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rev-erb beta/NR1D2 Antibody

  • BD73
  • EAR-1R
  • HZF2
  • NR1D2
  • nuclear receptor subfamily 1 group D member 2
  • nuclear receptor subfamily 1, group D, member 2
  • Orphan nuclear hormone receptor BD73
  • Reverb beta
  • Rev-erb beta
  • rev-erba-alpha-related receptor
  • rev-erb-beta
  • RVR
  • V-erbA-related protein 1-related

Background

The NR1D2 gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Al

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009572-M02
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
DAN00
Species: Hu
Applications: ELISA
NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
QET00B
Species: Hu
Applications: ELISA
NB600-836
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NLS54
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Rev-erb beta/NR1D2 Antibody (NBP2-47306) (0)

There are no publications for Rev-erb beta/NR1D2 Antibody (NBP2-47306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rev-erb beta/NR1D2 Antibody (NBP2-47306) (0)

There are no reviews for Rev-erb beta/NR1D2 Antibody (NBP2-47306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rev-erb beta/NR1D2 Antibody (NBP2-47306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rev-erb beta/NR1D2 Products

Bioinformatics Tool for Rev-erb beta/NR1D2 Antibody (NBP2-47306)

Discover related pathways, diseases and genes to Rev-erb beta/NR1D2 Antibody (NBP2-47306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rev-erb beta/NR1D2 Antibody (NBP2-47306)

Discover more about diseases related to Rev-erb beta/NR1D2 Antibody (NBP2-47306).
 

Pathways for Rev-erb beta/NR1D2 Antibody (NBP2-47306)

View related products by pathway.

PTMs for Rev-erb beta/NR1D2 Antibody (NBP2-47306)

Learn more about PTMs related to Rev-erb beta/NR1D2 Antibody (NBP2-47306).

Blogs on Rev-erb beta/NR1D2

There are no specific blogs for Rev-erb beta/NR1D2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rev-erb beta/NR1D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1D2