retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Western Blot: retinol dehydrogenase 8 (all trans) Antibody [NBP3-09458] - Western blot analysis of retinol dehydrogenase 8 (all trans) in A549 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

retinol dehydrogenase 8 (all trans) Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human retinol dehydrogenase 8 (all trans) (NP_056540). Peptide sequence FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RDH8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

• photoreceptor outer segment all-trans retinol dehydrogenase
• PRRDH
• retinol dehydrogenase 8 (all-trans)
• retinol dehydrogenase 8
• SDR28C2
• short chain dehydrogenase/reductase family 28C, member 2

Background

All-trans-retinol dehydrogenase (RDH8) is a visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol in the presence of NADPH (Rattner et al., 2000 [PubMed 10753906]). It is a member of the short chain dehydrogenase/reductase family and is located in the outer segments of photoreceptors; hence it is also known as photoreceptor retinol dehydrogenase. It is important in the visual cycle by beginning the rhodopsin regeneration pathway by reducing all-trans-retinal, the product of bleached and hydrolysed rhodopsin (Rando, 2001 [PubMed 11710234]). This is a rate-limiting step in the visual cycle (Saari et al., 1998 [PubMed 9667000]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RDH8