Ret Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Ret Antibody [NBP1-84568] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: Ret Antibody [NBP1-84568] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ret Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RET
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ret Protein (NBP1-84568PEP)
Publications
Read Publications using NBP1-84568.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22751117)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ret Antibody

  • CDHF12MTC1
  • CDHR16
  • EC 2.7.10
  • Hirschsprung disease 1
  • Hirschsprung disease)
  • MEN2A
  • MEN2B
  • multiple endocrine neoplasia and medullary thyroid carcinoma 1
  • ret proto-oncogene
  • RET transforming sequence
  • Ret

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84568
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Ret Antibody (NBP1-84568)(2)

Reviews for Ret Antibody (NBP1-84568) (0)

There are no reviews for Ret Antibody (NBP1-84568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ret Antibody (NBP1-84568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ret Products

Bioinformatics Tool for Ret Antibody (NBP1-84568)

Discover related pathways, diseases and genes to Ret Antibody (NBP1-84568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ret Antibody (NBP1-84568)

Discover more about diseases related to Ret Antibody (NBP1-84568).
 

Pathways for Ret Antibody (NBP1-84568)

View related products by pathway.

PTMs for Ret Antibody (NBP1-84568)

Learn more about PTMs related to Ret Antibody (NBP1-84568).
 

Research Areas for Ret Antibody (NBP1-84568)

Find related products by research area.

Blogs on Ret.

Beta III tubulin
The Beta III tubulin protein is abundantly present in both the central and peripheral nervous systems (CNS and PNS), where it is predominantly expressed during fetal and postnatal development. In cerebellar and sympathoadrenal neurogenesis, Beta III d...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ret Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RET
Entrez
Uniprot