REPIN1 Antibody (2X2E9)

Western Blot:REPIN1 Antibody (2X2E9)-Analysis of lysates from K-562 cells using REPIN1 Rabbit mAb at 1:40000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 45s.

Immunohistochemistry-Paraffin:REPIN1 Antibody (2X2E9)-Human colon tissue using REPIN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin:REPIN1 Antibody (2X2E9)-Human colon carcinoma tissue using REPIN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Western Blot: REPIN1 Antibody (2X2E9) [NBP3-33519] - Western Blot analysis of lysates from K-562 cells using REPIN1 Rabbit mAb at 1:40000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 45s.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2X2E9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

REPIN1 Antibody (2X2E9) Summary

• Description: Novus Biologicals Rabbit REPIN1 Antibody (2X2E9) (NBP3-33519) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 376-567 of human REPIN1 (NP_037532.2).
  
  Sequence:
  SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: REPIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:20000 - 1:80000
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for REPIN1 Antibody (2X2E9)

• 60 kDa origin-specific DNA-binding protein
• 60 kDa replication initiation region protein
• ATT-binding protein
• DHFR oribeta-binding protein RIP60
• H_DJ0584D14.12
• replication initiation region protein (60kD)
• replication initiator 1
• RIP60AP4
• Zfp464
• zinc finger protein 464 (RIP60)
• Zinc finger protein 464
• zinc finger protein AP4
• zinc finger proten AP4
• ZNF464

Background

REPIN1, also known as Replication initiator 1, is a 64kDa 567 amino acid protein that can be found in the nucleus. This gene is necessary for the process of initiating the chromosomal DNA replication. REPIN1 has been researched in relation to acrodermatitis enteropathica, enteropathica, acrodermatitis and immunodeficiency. REPIN1 has been linked to the synaptic transmission, cell proliferation, DNA replication, fatty acid transport and cell growth pathways where it interacts with GMNN, HDAC3, HDAC1, HDAC2 and GATA3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REPIN1