Renalase Antibody - BSA Free

Western Blot: Renalase Antibody [NBP1-98475] - Positive Control: Lane 1: 40 ug Mouse kidney tissue lysate Lane 2: 40 ug Mouse kidney tissue lysate Primary Antibody Dilution : 1:500 Secondary Antibody : Anti-rabbit-HRP Secondry Antibody Dilution : 1:2500

Western Blot: Renalase Antibody [NBP1-98475] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Western Blot: Renalase Antibody [NBP1-98475] - Sample Tissue: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Renalase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Renalase - middle region. Peptide sequence GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNLS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Renalase Antibody - BSA Free

• C10orf59
• C10orf59chromosome 10 open reading frame 59
• EC 1.4
• FLJ11218
• MAO-C
• Monoamine oxidase-C
• Renalase
• renalase, FAD-dependent amine oxidase
• RNLS

Background

Rnls is a probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. It degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. It lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNLS
• Uniprot:
  • NP_001161290(Mouse)