Renalase Antibody (9A5T7)

Western Blot: Renalase Antibody (9A5T7) [NBP3-15922] - Western blot analysis of extracts of various cell lines, using Renalase Rabbit mAb (NBP3-15922) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Mu, Rt
• Applications: WB
• Clone: 9A5T7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Renalase Antibody (9A5T7) Summary

• Description: Novus Biologicals Rabbit Renalase Antibody (9A5T7) (NBP3-15922) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renalase (Q5VYX0). MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RNLS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Renalase Antibody (9A5T7)

• C10orf59
• C10orf59chromosome 10 open reading frame 59
• EC 1.4
• FLJ11218
• MAO-C
• Monoamine oxidase-C
• Renalase
• renalase, FAD-dependent amine oxidase
• RNLS

Background

Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNLS