Recombinant Human RelA/NFkB p65 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related RelA/NFkB p65 Peptides and Proteins

Order Details


    • Catalog Number
      H00005970-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human RelA/NFkB p65 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 432-505 of Human RelA/NFkB p65

Source: Wheat Germ

Amino Acid Sequence: GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RELA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
33.88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RelA/NFkB p65 Protein

  • MGC131774
  • nf kb p65
  • NFkB p65
  • NF-kB p65
  • NFKB3
  • NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65))
  • Nuclear factor NF-kappa-B p65 subunit
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65
  • p65
  • p65RelA
  • rela p65
  • RelA
  • v-rel reticuloendotheliosis viral oncogene homolog A (avian)
  • v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65

Background

RELA - v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65 (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF2699
Species: Mu
Applications: Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
H00005970-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for RelA/NFkB p65 Partial Recombinant Protein (H00005970-Q01) (0)

There are no publications for RelA/NFkB p65 Partial Recombinant Protein (H00005970-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RelA/NFkB p65 Partial Recombinant Protein (H00005970-Q01) (0)

There are no reviews for RelA/NFkB p65 Partial Recombinant Protein (H00005970-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RelA/NFkB p65 Partial Recombinant Protein (H00005970-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RelA/NFkB p65 Products

Research Areas for RelA/NFkB p65 Partial Recombinant Protein (H00005970-Q01)

Find related products by research area.

Blogs on RelA/NFkB p65.

Killing two birds with one stone: Treating inflammation and cancer by inhibiting prolyl-4-hydroxylase-1
By Jamshed Arslan Pharm.D. The cell’s oxygen-sensing machinery comprises prolyl-4-hydroxylases (P4Hs 1-3, PHDs 1-3, or EGLN 1-3) and their canonical target hypoxia-inducible factors (HIFs). When oxygen levels ...  Read full blog post.

The effect of antioxidants and the NFkB p65 pathway in inflammation
NFkB is a transcription factor that plays a role in the expression of genes involved in immune response, inflammation, metastasis, cell survival and more. RelA (p65) is one member of the NFkB mammalian family, alongside other subunits. NFkB subunit...  Read full blog post.

NFkB3-p65: Say that three times fast!
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes such as inflammation, immunity, differentiation, cell growth, tumor genesis and apoptosis. Unlike the majority of transcription factors that reside in the nucleus...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RelA/NFkB p65 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RELA