RED2 Antibody

Images

 
Western Blot: RED2 Antibody [NBP1-57558] - Human Fetal Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RED2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADARB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-57558.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29719497).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RED2 Antibody

  • ADAR3adenosine deaminase, RNA-specific, B2 (RED1 homolog rat)
  • adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)
  • adenosine deaminase, RNA-specific, B2
  • double-stranded RNA-specific editase B2
  • dsRNA adenosine deaminase B2
  • EC 3.5
  • EC 3.5.1.2
  • EC 3.5.4
  • FLJ25034
  • homolog of rat BLUE
  • hRED2
  • RED2 homolog
  • RED2FLJ36975
  • RNA-dependent adenosine deaminase 3
  • RNA-editing deaminase 2
  • RNA-editing enzyme 2

Background

ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 DA533361.1 1-48 49-369 AF034837.1 9-329 370-474 AI695657.1 188-292 c 475-2821 AF034837.1 435-2781 2822-3521 AL392083.17 12183-12882 c 3522-3668 BC047443.1 1389-1535

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66402
Species: Hu
H00000104-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-49106
Species: Hu
Applications: WB, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF3297
Species: Hu
Applications: WB
AF4237
Species: Mu
Applications: WB, IHC
H00001646-M03
Species: Hu
Applications: WB, ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5480
Species: Hu
Applications: IHC
H00003836-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-57521
Species: Hu, Mu
Applications: WB, IP
NBP1-88622
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03061
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77939
Species: Hu, Mu, Rt, Ca, Ch, Ze
Applications: WB, ELISA
NBP1-57558
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for RED2 Antibody (NBP1-57558)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for RED2 Antibody (NBP1-57558) (0)

There are no reviews for RED2 Antibody (NBP1-57558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RED2 Antibody (NBP1-57558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RED2 Products

Array NBP1-57558

Bioinformatics Tool for RED2 Antibody (NBP1-57558)

Discover related pathways, diseases and genes to RED2 Antibody (NBP1-57558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RED2 Antibody (NBP1-57558)

Discover more about diseases related to RED2 Antibody (NBP1-57558).
 

Pathways for RED2 Antibody (NBP1-57558)

View related products by pathway.

Blogs on RED2

There are no specific blogs for RED2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RED2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADARB2
Entrez
Uniprot