RED2 Antibody

Western Blot: RED2 Antibody [NBP1-57558] - Human Fetal Heart lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

RED2 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADARB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 80 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29719497).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RED2 Antibody

• ADAR3adenosine deaminase, RNA-specific, B2 (RED1 homolog rat)
• adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)
• adenosine deaminase, RNA-specific, B2
• double-stranded RNA-specific editase B2
• dsRNA adenosine deaminase B2
• EC 3.5
• EC 3.5.1.2
• EC 3.5.4
• FLJ25034
• homolog of rat BLUE
• hRED2
• RED2 homolog
• RED2FLJ36975
• RNA-dependent adenosine deaminase 3
• RNA-editing deaminase 2
• RNA-editing enzyme 2

Background

ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 DA533361.1 1-48 49-369 AF034837.1 9-329 370-474 AI695657.1 188-292 c 475-2821 AF034837.1 435-2781 2822-3521 AL392083.17 12183-12882 c 3522-3668 BC047443.1 1389-1535

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RED2 Antibody (NBP1-57558)(2)

Publications using NBP1-57558

• Hao X, Shiromoto Y, Sakurai M et al. ADAR1 downregulation by autophagy drives senescence independently of RNA editing by enhancing p16INK4a levels Nature cell biology 2022-07-18 [PMID: 35851616] (WB, Mouse)
• Mladenova D, Barry G, Konen L et al. Adar3 Is Involved in Learning and Memory in Mice. Front. Neurosci. 2018-04-13 [PMID: 29719497] (Mouse)

Bioinformatics

• Gene Symbol: ADARB2
• Entrez:
  • 105(Human)
• Uniprot:
  • Q9NS39(Human)