The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADARB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
80 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-57558 in the following applications:
ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 DA533361.1 1-48 49-369 AF034837.1 9-329 370-474 AI695657.1 188-292 c 475-2821 AF034837.1 435-2781 2822-3521 AL392083.17 12183-12882 c 3522-3668 BC047443.1 1389-1535
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for RED2 Antibody (NBP1-57558)
Discover related pathways, diseases and genes to RED2 Antibody (NBP1-57558). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for RED2 Antibody (NBP1-57558)
Discover more about diseases related to RED2 Antibody (NBP1-57558).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our RED2 Antibody and receive a gift card or discount.