RECQ1 Antibody

Images

 
Western Blot: RECQ1 Antibody [NBP2-57572] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RECQ1 Antibody [NBP2-57572] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RECQ1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKILKQ
Specificity
Specificity of human RECQ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RECQL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RECQ1 Antibody

  • DNA helicase, RecQ-like type 1
  • DNA-dependent ATPase Q1
  • EC 3.6.1
  • EC 3.6.4.12
  • RecQ protein-like (DNA helicase Q1-like)
  • RecQ protein-like 1
  • RECQ1
  • RecQ1ATP-dependent DNA helicase Q1
  • RecQL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-214
Species: Hu, Mu
Applications: WB, IP
NB100-471
Species: Hu
Applications: WB, ICC/IF, IP, ChIP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-33169
Species: Hu, Mu
Applications: WB
NBP2-13962
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-56122
Species: Hu
Applications: ICC/IF
NBP2-67219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP2-33916
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu, Rt, Kg
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-56408
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57572
Species: Hu
Applications: WB, ICC/IF

Publications for RECQ1 Antibody (NBP2-57572) (0)

There are no publications for RECQ1 Antibody (NBP2-57572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RECQ1 Antibody (NBP2-57572) (0)

There are no reviews for RECQ1 Antibody (NBP2-57572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RECQ1 Antibody (NBP2-57572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RECQ1 Products

Bioinformatics Tool for RECQ1 Antibody (NBP2-57572)

Discover related pathways, diseases and genes to RECQ1 Antibody (NBP2-57572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RECQ1 Antibody (NBP2-57572)

Discover more about diseases related to RECQ1 Antibody (NBP2-57572).
 

Pathways for RECQ1 Antibody (NBP2-57572)

View related products by pathway.

PTMs for RECQ1 Antibody (NBP2-57572)

Learn more about PTMs related to RECQ1 Antibody (NBP2-57572).
 

Research Areas for RECQ1 Antibody (NBP2-57572)

Find related products by research area.

Blogs on RECQ1

There are no specific blogs for RECQ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RECQ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RECQL