RDH10 Antibody - BSA Free

Western Blot: RDH10 Antibody [NBP2-85617] - WB Suggested Anti-Rdh10 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Liver

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RDH10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RDH10 Antibody - BSA Free (NBP2-85617) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of RDH10. Peptide sequence: CPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RDH10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RDH10 Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.300
• EC 1.1.1.n2
• retinol dehydrogenase 10 (all-trans)
• retinol dehydrogenase 10
• SDR16C4
• short chain dehydrogenase/reductase family 16C, member 4

Background

RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle. All-trans retinal is isomerized to 11-cis retinal by the retinal G protein-coupled receptor (RGR; MIM 600342) when the retinal pigment epithelium (RPE) is illuminated.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RDH10