RCAN2 Antibody

Images

 
Western Blot: RCAN2 Antibody [NBP3-09305] - Western blot analysis of RCAN2 in COLO205 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCAN2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of HUMAN RCAN2. Peptide sequence VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE
Clonality
Polyclonal
Host
Rabbit
Gene
RCAN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for RCAN2 Antibody

  • Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2)
  • calcipressin-2
  • Down syndrome candidate region 1-like 1
  • Down syndrome critical region gene 1-like 1
  • DSCR1L1MCIP2ZAKI4RCN2
  • hRCN2
  • Myocyte-enriched calcineurin-interacting protein 2
  • regulator of calcineurin 2CSP2
  • thyroid hormone-responsive (skin fibroblasts)
  • Thyroid hormone-responsive protein ZAKI-4
  • ZAKI-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46852
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-84972
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87974
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45511
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-91745
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83483
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-93985
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
233-FB/CF
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
923-AN/CF
Species: Hu
Applications: BA
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB

Publications for RCAN2 Antibody (NBP3-09305) (0)

There are no publications for RCAN2 Antibody (NBP3-09305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCAN2 Antibody (NBP3-09305) (0)

There are no reviews for RCAN2 Antibody (NBP3-09305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCAN2 Antibody (NBP3-09305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCAN2 Products

Bioinformatics Tool for RCAN2 Antibody (NBP3-09305)

Discover related pathways, diseases and genes to RCAN2 Antibody (NBP3-09305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCAN2 Antibody (NBP3-09305)

Discover more about diseases related to RCAN2 Antibody (NBP3-09305).
 

Pathways for RCAN2 Antibody (NBP3-09305)

View related products by pathway.

PTMs for RCAN2 Antibody (NBP3-09305)

Learn more about PTMs related to RCAN2 Antibody (NBP3-09305).
 

Research Areas for RCAN2 Antibody (NBP3-09305)

Find related products by research area.

Blogs on RCAN2

There are no specific blogs for RCAN2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCAN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCAN2