RCAN2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit RCAN2 Antibody - BSA Free (NBP3-09305) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of HUMAN RCAN2. Peptide sequence VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RCAN2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for RCAN2 Antibody - BSA Free
Background
Calcipressin-2, also known as RCAN2, plays a key role in many physiological procedures. Expressed in fibroblasts, heart, brain, liver, and skeletal muscle, RCAN2 prevents calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Translocation of the transcription factor NFATC1 can also be attributed to the binding of calcineurin A. Further research indicates that RCAN could also play a role in endothelial cell function, angiogenesis and central nervous system development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ec
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Publications for RCAN2 Antibody (NBP3-09305) (0)
There are no publications for RCAN2 Antibody (NBP3-09305).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RCAN2 Antibody (NBP3-09305) (0)
There are no reviews for RCAN2 Antibody (NBP3-09305).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RCAN2 Antibody (NBP3-09305) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RCAN2 Products
Research Areas for RCAN2 Antibody (NBP3-09305)
Find related products by research area.
|
Blogs on RCAN2