RBPMS Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBPMS. Source: E. coli
Amino Acid Sequence: PSTPLPNTVPQFIAREPYELTVPALYPSSPEV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RBPMS |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33810. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for RBPMS Recombinant Protein Antigen
Background
Encoded by a member of the RRM family of RNA-binding proteins, RBPMS is involved in nucleic acid, nucleotide, RNA and protein binding. The RRM family can be found between 80-100 amino acids in length. RBPMS also acts as a coactivator of transcriptional activity and is required for TGFB1/Smad-mediated transactivation. More specifically, RBPMS acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity while promoting the nuclear accumulation of these proteins. Diseases associated with RBPMS include hepatocellular carcinoma, ataxia, carcinoma and neuronitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu
Applications: AC
Publications for RBPMS Protein (NBP2-33810PEP) (0)
There are no publications for RBPMS Protein (NBP2-33810PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RBPMS Protein (NBP2-33810PEP) (0)
There are no reviews for RBPMS Protein (NBP2-33810PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RBPMS Protein (NBP2-33810PEP) (0)
Additional RBPMS Products
Research Areas for RBPMS Protein (NBP2-33810PEP)
Find related products by research area.
|
Blogs on RBPMS