RBPMS Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PSTPLPNTVPQFIAREPYELTVPALYPSSPEV |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RBPMS |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 0.04-0.4 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for RBPMS Antibody
Background
Encoded by a member of the RRM family of RNA-binding proteins, RBPMS is involved in nucleic acid, nucleotide, RNA and protein binding. The RRM family can be found between 80-100 amino acids in length. RBPMS also acts as a coactivator of transcriptional activity and is required for TGFB1/Smad-mediated transactivation. More specifically, RBPMS acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity while promoting the nuclear accumulation of these proteins. Diseases associated with RBPMS include hepatocellular carcinoma, ataxia, carcinoma and neuronitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for RBPMS Antibody (NBP2-33810) (0)
There are no publications for RBPMS Antibody (NBP2-33810).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RBPMS Antibody (NBP2-33810) (0)
There are no reviews for RBPMS Antibody (NBP2-33810).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RBPMS Antibody (NBP2-33810) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RBPMS Products
Research Areas for RBPMS Antibody (NBP2-33810)
Find related products by research area.
|
Blogs on RBPMS