RBP3 Antibody (4F3)

Images

 
Sandwich ELISA: RBP3 Antibody (4F3) [H00005949-M01] - Detection limit for recombinant GST tagged RBP3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RBP3 Antibody (4F3) Summary

Immunogen
RBP3 (NP_002891 1149 a.a. - 1246 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
Specificity
RBP3 - retinol binding protein 3, interstitial
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBP3 Antibody (4F3)

  • D10S64
  • D10S65
  • D10S66
  • Interphotoreceptor retinoid-binding protein
  • Interstitial retinol-binding protein
  • IRBP
  • RBPI
  • retinol binding protein 3, interstitial
  • retinol-binding protein 3
  • retinol-binding protein 3, interstitial

Background

Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5 kbp in length and consists of four exons separated by three introns. The introns are 1.6-1.9 kbp long. The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da. The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events. In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected. The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long. The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB5756
Species: Hu
Applications: Flow
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74392
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
BPI
7468-BP
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RBP3 Antibody (H00005949-M01) (0)

There are no publications for RBP3 Antibody (H00005949-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP3 Antibody (H00005949-M01) (0)

There are no reviews for RBP3 Antibody (H00005949-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBP3 Antibody (H00005949-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP3 Products

Bioinformatics Tool for RBP3 Antibody (H00005949-M01)

Discover related pathways, diseases and genes to RBP3 Antibody (H00005949-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP3 Antibody (H00005949-M01)

Discover more about diseases related to RBP3 Antibody (H00005949-M01).
 

Pathways for RBP3 Antibody (H00005949-M01)

View related products by pathway.

PTMs for RBP3 Antibody (H00005949-M01)

Learn more about PTMs related to RBP3 Antibody (H00005949-M01).

Blogs on RBP3

There are no specific blogs for RBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBP3 Antibody (4F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP3
Entrez
OMIM
Uniprot