Home » RBM12 » RBM12 Antibodies » RBM12 Antibody (1D12)

RBM12 Antibody (1D12)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RBM12 Antibody (1D12) [H00010137-M05] - Analysis of RBM12 expression in transfected 293T cell line by RBM12 monoclonal antibody (M05), clone 1D12. Lane 1: RBM12 transfected lysate (Predicted MW: 97.4 KDa). Lane 2: Non-transfected lysate.
Western Blot: RBM12 Antibody (1D12) [H00010137-M05] - Analysis of RBM12 expression in transfected 293T cell line by RBM12 monoclonal antibody (M05), clone 1D12. Lane 1: RBM12 transfected lysate (Predicted MW: 97.4 KDa). ...read more
ELISA: RBM12 Antibody (1D12) [H00010137-M05] - Detection limit for recombinant GST tagged RBM12 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RBM12 Antibody (1D12) Summary

Immunogen
RBM12 (NP_006038.2, 834 a.a. ~ 932 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
Specificity
RBM12 - RNA binding motif protein 12 (1D12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBM12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00010137-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM12 Antibody (1D12)

  • KIAA0765SWANHRIHFB2091
  • RNA binding motif protein 12
  • RNA-binding motif protein 12
  • RNA-binding protein 12
  • SH3/WW domain anchor protein in the nucleus

Background

This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in two transcript variants. Both variants encode the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunoprecipitation: BRD2 Antibody [NBP1-30475] - Detection of human BRD2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for IP at 6 ug per reaction. BRD2 was also immunoprecipitated by rabbit anti-BRD2 antibody NBP1-30474 and rabbit anti-BRD2 recombinant monoclonal antibody [BL-167-2A2] (NBP2-76410). For blotting immunoprecipitated BRD2, NBP2-76410 was used at 1:1000. Detection: Chemiluminescence with an exposure time time of 3 minutes.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
SHBG [HRP]
DSHBG0B
(10 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ER beta/NR3A2
Antibody (14C8)
NB200-305
Immunohistochemistry-Paraffin: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Human breast carcinoma. Estrogen Receptor beta stained by Estrogen Receptor beta antibody [14C8] diluted at 1:200. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: Estrogen Receptor beta Antibody (14C8) [NB200-305] - Infiltrating lobular carcinoma of the breast.
Western Blot: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Estrogen Receptor beta antibody [14C8] diluted at 1:5000. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody
(75 Publications)
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
C-Reactive
Protein/CRP [HRP]
DCRP00
(134 Publications)
Species: Hu
Applications: ELISA
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot: GRIP1 Antibody [NBP2-41211] - Analysis of GRIP1 in 293 cell lysate with GRIP1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunofluorescence: GRIP1 Antibody [NBP2-41211] - Immunofluorescence of GRIP1 in rat brain tissue with GRIP1 antibody at 20 ug/ml.
Immunohistochemistry: GRIP1 Antibody [NBP2-41211] - Immunohistochemistry of GRIP1 in rat brain tissue with GRIP1 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Western Blot: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control (C; open bar; n = 6) and hypothyroid (Hypo; solid bar; n = 6) rabbits. Representative immunoblot showing the expression of aromatase. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of hypothyroid (Hypo; solid bar; n = 6) rabbits. Immunoreactivity of antiaromatase (+) was identified in granulosa cells of antral follicles (tertiary, tf; Graafian, gf) of hypothyroid ovaries. Nonlabeling was observed when the primary antibody was omitted. Bars: 100 um (1st image); and 20 um (2nd image). Granulose cells, gc; theca cells, tc. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin-embedded sections of human brain using Mouse Anti-Human Bestrophin 1 (E6-6) Monoclonal Antibody (Catalog # NB300-164) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in neurons.
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin sections of human small intestine using t Mouse Anti-Human Bestrophin 1 Monoclonal Antibody (Catalog # NB300-164) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cell surface and extracellular.
Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.
(1 Review)
(45 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
TEF1 Antibody
NBP2-94035
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1 .
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
CD55/DAF was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using 15 µg/mL Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CD55/DAF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line (left panel, positive staining) and MOLT-4 human acute lymphoblastic leukemia cell line (right panel, negative staining) using Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) at 0.5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: ICC, IHC
NCKIPSD Antibody
NBP1-42664
NCKIPSD Antibody [NBP1-42664] - Detection of human SPIN90 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-SPIN90 antibody NBP1-42664 (lot NBP1-42664-2) used for IP at 6 ug per reaction. SPIN90 was also immunoprecipitated by a previous lot of this antibody NBP1-42664-1. For blotting immunoprecipitated SPIN90, NBP1-42664 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: NCKIPSD Antibody [NBP1-42664] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- SPIN90 used at a dilution of 1:500 (0.4ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Western Blot: NCKIPSD Antibody [NBP1-42664] - Detection of Human SPIN90 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-SPIN90 antibody NBP1-42664 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Species: Hu
Applications: IHC, IP, WB
Cytochrome P450
1A1/1A2 Antibody (MC1
NB100-74398
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of HT29 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescentred phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of COS-7 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
(1 Review)
(2 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Lysozyme Antibody
- BSA Free
NBP2-61118
Simple Western: Lysozyme Antibody [NBP2-61118] - Lane view shows lysates of Ileum stem cells undifferentiated and day 5 differentiated, loaded at 0.2 mg/mL. A specific band was detected for Lysozyme at approximately 20 kDa (as indicated) using 20 ug/mL of Rabbit Anti-Lysozyme Polyclonal Antibody (NBP2-61118). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Flow Cytometry: Lysozyme Antibody [NBP2-61118] - An intracellular stain was performed on THP-1 Cells with NBP2-61118 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG APC-conjugated Secondary Antibody (R&D Systems, F0111).
Immunocytochemistry/Immunofluorescence: Lysozyme Antibody [NBP2-61118] - NIH3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Lysozyme NBP2-61118 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(5 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
PIAS2 Antibody
NBP1-52022
Western Blot: PIAS2 Antibody [NBP1-52022] - Western blot analysis of PIAS2 (aa185-196) in Human Peripheral Lymphocytes lysate (35ug protein in RIPA buffer) using NBP1-52022 at 1ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: PIAS2 Antibody [NBP1-52022] - WB analysis of PIAS2 using anti-PIAS2 antibody on Jurkat cell lyste (30 ug cell lysate boiled in lysis buffer). Image from verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
RBM12 Antibody
(1D12)
H00010137-M05
RBM12 Antibody (1D12)
Species: Hu
Applications: WB, ELISA

Publications for RBM12 Antibody (H00010137-M05)(1)


Reviews for RBM12 Antibody (H00010137-M05) (0)

There are no reviews for RBM12 Antibody (H00010137-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM12 Antibody (H00010137-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM12 Products

Bioinformatics Tool for RBM12 Antibody (H00010137-M05)

Discover related pathways, diseases and genes to RBM12 Antibody (H00010137-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM12 Antibody (H00010137-M05)

Discover more about diseases related to RBM12 Antibody (H00010137-M05).
 

Pathways for RBM12 Antibody (H00010137-M05)

View related products by pathway.

Blogs on RBM12

There are no specific blogs for RBM12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM12 Antibody (1D12) and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM12
Entrez
Uniprot