RBM12 Antibody (1D12)

Images

 
Western Blot: RBM12 Antibody (1D12) [H00010137-M05] - Analysis of RBM12 expression in transfected 293T cell line by RBM12 monoclonal antibody (M05), clone 1D12. Lane 1: RBM12 transfected lysate (Predicted MW: 97.4 KDa). ...read more
ELISA: RBM12 Antibody (1D12) [H00010137-M05] - Detection limit for recombinant GST tagged RBM12 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RBM12 Antibody (1D12) Summary

Immunogen
RBM12 (NP_006038.2, 834 a.a. ~ 932 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
Specificity
RBM12 - RNA binding motif protein 12 (1D12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBM12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00010137-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM12 Antibody (1D12)

  • KIAA0765SWANHRIHFB2091
  • RNA binding motif protein 12
  • RNA-binding motif protein 12
  • RNA-binding protein 12
  • SH3/WW domain anchor protein in the nucleus

Background

This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in two transcript variants. Both variants encode the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
DSHBG0B
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-42664
Species: Hu
Applications: IHC, IP, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-52022
Species: Hu
Applications: PEP-ELISA, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
H00010137-M05
Species: Hu
Applications: WB, ELISA

Publications for RBM12 Antibody (H00010137-M05)(1)


Reviews for RBM12 Antibody (H00010137-M05) (0)

There are no reviews for RBM12 Antibody (H00010137-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM12 Antibody (H00010137-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM12 Products

Bioinformatics Tool for RBM12 Antibody (H00010137-M05)

Discover related pathways, diseases and genes to RBM12 Antibody (H00010137-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM12 Antibody (H00010137-M05)

Discover more about diseases related to RBM12 Antibody (H00010137-M05).
 

Pathways for RBM12 Antibody (H00010137-M05)

View related products by pathway.

Blogs on RBM12

There are no specific blogs for RBM12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM12 Antibody (1D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM12
Entrez
Uniprot