RBM10 Antibody


Western Blot: RBM10 Antibody [NBP2-56831] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: RBM10 Antibody [NBP2-56831] - Staining of human cell line A-431 shows localization to nuclear speckles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

RBM10 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST
Specificity of human RBM10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM10 Recombinant Protein Antigen (NBP2-56831PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RBM10 Antibody

  • DXS8237ERNA-binding motif protein 10
  • G patch domain-containing protein 9
  • GPATCH9MGC1132
  • KIAA0122RNA-binding protein S1-1
  • MGC997
  • RNA binding motif protein 10
  • RNA-binding protein 10
  • S1-1
  • ZRANB5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RBM10 Antibody (NBP2-56831) (0)

There are no publications for RBM10 Antibody (NBP2-56831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM10 Antibody (NBP2-56831) (0)

There are no reviews for RBM10 Antibody (NBP2-56831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM10 Antibody (NBP2-56831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RBM10 Products

Bioinformatics Tool for RBM10 Antibody (NBP2-56831)

Discover related pathways, diseases and genes to RBM10 Antibody (NBP2-56831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM10 Antibody (NBP2-56831)

Discover more about diseases related to RBM10 Antibody (NBP2-56831).

Pathways for RBM10 Antibody (NBP2-56831)

View related products by pathway.

PTMs for RBM10 Antibody (NBP2-56831)

Learn more about PTMs related to RBM10 Antibody (NBP2-56831).

Blogs on RBM10

There are no specific blogs for RBM10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBM10 Antibody and receive a gift card or discount.


Gene Symbol RBM10