RBM6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RBM6 Antibody [NBP1-89377] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies.

Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89377] - Staining of human lymph node shows strong nuclear positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89377] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89377] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89377] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Staining of human cerebral cortex, gastrointestinal, kidney and lymphoid tissues using Anti-RBM6 antibody NBP1-89377 (A) shows similar protein distribution across tissues to independent antibody NBP1-89376 (B).

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM6 Protein (NBP1-89377PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM6 Antibody - BSA Free

• DEF-3
• DEF3FLJ39446,3G2
• DKFZp686B0877
• FLJ36517
• FLJ42036
• g16
• HLC-11
• Lung cancer antigen NY-LU-12
• lung cancer protooncogene 11
• NY-LU-12
• Protein G16
• RNA binding motif protein 6
• RNA-binding motif protein 6
• RNA-binding protein 6
• RNA-binding protein DEF-3

Background

RBM6 (RNA binding motif protein 6) contains an RNA recognition motif found in a variety of RNA binding proteins that function in RNA processing. RBM6 has also been identified as DEF-3, a gene that is differentially expressed during hematopoiesis and as G16, a gene that maps to a tumor suppressor locus involved in lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM6