RB associated KRAB repressor Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RB associated KRAB repressor Antibody [NBP2-55962] - Staining of human cell line MCF7 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RB associated KRAB repressor Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RB associated KRAB repressor Antibody - BSA Free (NBP2-55962) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBAK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RB associated KRAB repressor Antibody - BSA Free

• hRBaK
• RB-associated KRAB repressor
• RB-associated KRAB zinc finger protein
• RB-associated KRAB zinc finger
• ZNF769Zinc finger protein 769

Background

RB associated KRAB repressor, also known as ZNF769, consists of a 83 kDa 714 and a shorter 12 kDa 113 isoform. Its function is to promote AR-dependent transcription by encoding a nuclear protein. Current research on RB associated KRAB repressor is being conducted in its relationship to retinoblastoma, hyperaldosteronism and familial hyperaldosteronism. RB associated KRAB repressor is known to interact with SUMO1, RB1, AR and SMARCAD1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBAK